Plenum den 3 april 2013 kl. 13.00

 Ålands lagting

PLENARPROTOKOLL

 

 

 

 

 

M W-A


Plenum den 3 april 2013 kl. 13.00

Plenum börjar. 2

Bordläggning. 2

1    Ändringar i samfundsbeskattningen 2013-2016

Finans- och näringsutskottets betänkande (FNU 14/2012-2013)

Landskapsregeringens lagförslag (LF 10/2012-2013)

Bordläggning. 2

2    Ungdomsarbetslöshet och risk för marginalisering

Landskapsregeringens svar (S 3/2012-2013-s)

Ltl Katrin Sjögrens m.fl. spörsmål (S 3/2012-2013)

Remiss. 2

3    Godkännande av det fakultativa protokollet till konventionen mot tortyr

Landskapsregeringens svar (RP 12/2012-2013-s)

Republikens presidents framställning (RP 12/2012-2013)

Andra behandling. 5

4    Ett ramverk för införande av intelligenta vägtrafiksystem

Finans- och näringsutskottets betänkande (FNU 13/2012-2013)

Landskapsregeringens lagförslag (LF 9/2012-2013)

Första behandling efter bordläggning. 5

5    Ny polislag

Lag- och kulturutskottets betänkande (LKU 6/2012-2013)

Landskapsregeringens lagförslag (LF 3/2012-2013)

Första behandling. 42

6    Plantmaterial och skydd för växters sundhet

Social- och miljöutskottets betänkande (SMU 3/2012-2013)

Landskapsregeringens lagförslag (LF 7/2012-2013)

Enda behandling. 45

7    Självstyrelsens kärnområden

Landskapsregeringens svar (S 2/2012-2013-s)

Ltl Axel Jonssons m.fl. spörsmål (S 2/2012-2013)

Enda behandling. 63

8    Talmannens representationsersättning

Talmanskonferensens lagförslag (TMK 3/2012-2013)

Föredras. 63

9    Förstärkning av rättssäkerheten i förvaltningen

Landskapsregeringens svar

Ltl Gunnar Janssons skriftliga fråga (SF 7/2012-2013)

Föredras. 63

10  Tryggande av fårnäringen

Landskapsregeringens svar

Ltl Torsten Sundbloms skriftliga fråga (SF 8/2012-2013)

För kännedom... 66

11  Godkännande av avtalet med Botswana om upplysningar i fråga om skatteärenden

Republikens presidents framställning (RP 13/2012-2013)

12  Energideklaration för byggnader

Landskapsregeringens lagförslag (LF 13/2012-2013)

13  Förslag till första tilläggsbudget för år 2013

Landskapsregeringens budgetförslag (BF 3/2012-2013)

14  Redogörelse enligt 32 § AO för Ålands lagting för tiden 1 november 2011-31 oktober 2012

Landskapsregeringens redogörelse (RS 2/2012-2013)

Plenum slutar. 66

 

Plenum börjar

Närvaroregistrering. 28 ledamöter närvarande.

Lagtingsledamoten Göte Wine anhåller om ledighet från dagens plenum på grund av vård av sjukt barn och från plenum 05.04 på grund av deltagande i partikongress i Göteborg. Beviljas.

Bordläggning

1        Ändringar i samfundsbeskattningen 2013-2016

Finans- och näringsutskottets betänkande (FNU 14/2012-2013)

Landskapsregeringens lagförslag (LF 10/2012-2013)

Talmannen föreslår att ärendet bordläggs till plenum 08.04.2013. Godkänt.

Bordläggning

2        Ungdomsarbetslöshet och risk för marginalisering

Landskapsregeringens svar (S 3/2012-2013-s)

Ltl Katrin Sjögrens m.fl. spörsmål (S 3/2012-2013)

När svaret på ett spörsmål föredras första gången ska ärendet enligt 38 § arbetsordningen bordläggas till ett plenum som hålls tidigast följande dag. Talmannen föreslår att ärendet bordläggs till plenum 15.04.2013. Godkänt.

Remiss

3        Godkännande av det fakultativa protokollet till konventionen mot tortyr

Landskapsregeringens svar (RP 12/2012-2013-s)

Republikens presidents framställning (RP 12/2012-2013)

Talmannens förslag är att detta ärende remitteras till lag- och kulturutskottet.

Diskussion.

Minister Gun-Mari Lindholm

Talman! Landskapsregeringen har gett ett yttrande till lagtinget i vederbörlig ordning då lagtinget har begärt in ett yttrande över republikens presidents framställning nr 12/2012-2013.

Landskapsregeringen understöder målsättningen med sakinnehållet i det fakultativa protokollet. Landskapsregeringen anser också att det finns förpliktelse som faller inom landskapets behörighet och att lagtingets bifall behövs för att sätta det ikraft.

Det här är ett fakultativt protokoll som hör till en konvention som lagtinget ska ge sitt bifall till för att den ska vara gällande på Åland.

Vi vet från tidigare att det finns flera konventioner som det råder tvivel om huruvida de är gällande på Åland eftersom lagtinget inte har gett sitt bifall, utan konventionerna har blivit gällande eftersom Finlands riksdag har antagit dem.

Det här ligger nu i självstyrelsepolitiska nämnden för avgörande, med anledning av en av de ESK-konventioner som var upp häromsistens här i lagtinget. Det finns också ett arbete i landskapsregeringen där man försöker lista upp alla de konventioner som man anser att lagtinget bör ge sitt bifall till, om det är så att man kommer fram till lagtinget inte har gett sitt bifall.

Vi får se var det här landar. Ytterst är det här är en sak för lagtinget att avgöra huruvida man hanterar den här frågan. Landskapregeringen bidrar förstås med det som vi kan. Vad gäller sakinnehållet så understöder vi målsättningen. Tack.

Ltl Gunnar Jansson, replik

Fru talman! I propositionen konstateras det lakoniskt att området för detta protokoll rör straffrätten lika som den underliggande konventionen och därför inte har underställts lagtinget tidigare. Det här problemet är klassiskt. Landskapsregeringen har gett två utlåtanden under beredningen av detta protokoll, men så vitt jag kan förstå av detta yttrande så har man överhuvudtaget inte berört problematiken om huruvida man tar ställning till tillägg till konventioner som aldrig har handlagts i Ålands lagting. Är det här ett förbiseende eller har landskapregeringen inte tagit ställning till den här omständigheten?

Minister Gun-Mari Lindholm, replik

Talman! I det här utlåtande för vi ett resonemang om just den problematiken. Vi tar inte ställning till det. Det är upp till lagtinget att bestämma om man anser att de tidigare konventionerna inte har blivit bifallda av lagtinget, och om det är så att lagtinget ska ge sitt bifall. Det är upp till lagtinget att bestämma. Landskapsregeringen har den här utredningen, vilket vi också kommer att sända över till självstyrelsepolitiska nämnden.

Talmannen

Replikskiftet är avslutat.

Ltl Wille Valve

Fru talman! I vår världsdel är vi rätt förskonade från de företeelser som i folkrätten brukar benämnas tortyr och annan grym, omänsklig eller förnedrande behandling eller bestraffning. Men inte helt, varken Finlands eller Sveriges sköldar är helt obefläckade i dessa sammanhang. Minns till exempel det medialt uppmärksammade fallet Osmo Vallo i Sverige, där en rapport från Sveriges Brottsförebyggande råd (BRÅ) så sent som 2010 slog fast att det onödiga våld polisen använde kan ha orsakat hans död.

I sak tror jag inte det finns en enda ledamot i denna sal som motsätter sig bestämmelserna i ”moderkonventionen” till detta protokoll eller de nya mekanismer som grundas i detta protokoll till skydd för medborganas friheter och rättigheter.

Vår ambition måste vara att våra verksamheter fungerar så bra att dessa mekanismer, artikel 11 i konventionen, aldrig ska behöva åberopas inom våra behörighetsområden – polis, hälso- och sjukvård, barnskydd eller socialvård. För, fru talman, det här handlar inte om polisbrutalitet. Det handlar om en massa verksamheter som finns landskapets behörighet. I propositionen nämns t.ex. psykiatriska vårdinrättningar, vårdinrättningar för äldre personer, vårdinrättningar för utvecklingsstörda och barnskyddsanstalter, till och med grov mobbning i skolan kan komma ifråga. I propositionen, sidan 19, kan vi notera att även privata ordningsvakter hör till tillämpningsområdet för artikel 4 i protokollet. 

Det som kan vara av särskilt intresse för Åland är om samma problematik föreligger här som med det fakultativa protokollet till den s.k. ESK-konventionen. Har också ”moderkonventionen” till detta protokoll satts ikraft i landskapet Åland på vederbörligt sätt? Klart är att det på riksnivå har antagits både en förordning och en lag om ikraftträdande för ”grundkonventionen” den 22 september 1989. Detta är något för det behöriga utskottet att studera närmare.

En annan sak, värt att studera närmare, är att justitieombudsmannens inspektionsverksamhet utvidgas, rimligtvis också på åländsk mark.

Fru talman! Detta protokoll och särskilt den nationella förebyggande mekanismen stärker förebyggandet av tortyr och annan grym, omänsklig eller förnedrande behandling eller bestraffning. Protokollet stärker skyddet för de grundläggande fri- och rättigheterna och de mänskliga rättigheterna, värden som vi moderater värnar.

Fru talman! Moderaterna stöder att lagtinget ger sitt bifall till detta protokoll, men vill understryka vikten av att ”grundkonventionen” har satts ikraft i vederbörlig ordning, då detta i ljuset av artikel 27 i protokollet måste betraktas som en förutsättning för att protokollet alls ska kunna träda ikraft i landskapet. Vi stöder att ärendet remitteras till lag- och kulturutskottet.

Ltl Danne Sundman

Fru talman! I sak är det precis såsom ltl Valve säger; ingen i den här salen skulle komma på tanken att motsätta sig det här protokollet eller den konvention som det här anknyter till. Man kanske kan säga att det är den allra innersta kärnan i de mänskliga rättigheterna. Den makt som vi ger till samhället i olika sammanhang över människors frihet ska inte missbrukas på något sätt, kan man säga i sammanfattande ord även om den här konventionen är väldigt bred.

Jag begärde ordet därför att när en tidigare liknande situation, där ett fakultativt protokoll till en konvention, ESK-konventionen, skulle behandlas här så uppkom frågan huruvida det var möjligt att behandla det när en konvention inte är satt i kraft inom landskapets behörighet. När det gäller det ärendet så ligger det i självstyrelsepolitiska nämnden som här i dagarna ska besluta om sitt yttrande till lag- och kulturutskottet.

Som jag ser det så är sådana här fakultativa, därav namnet, anknutna till konventionen och för att kunna sätta dem i kraft så måste det finnas en konvention som är satt ikraft också innanför självstyrelsens behörighet. Det råder inget tvivel om att det här gäller när det handlar om riksbehörighet.

Det finns mycket i den här konventionen som är helt eller delvis landskapets behörighet och därför är det här protokollet här på lagtingets bord idag. Som jag ser det kan man inte ta ställning till ett sådant här protokoll när man inte har en konvention i kraft. Det blir att hänga i luften, det blir ungefär som ”eftersläpar jolle” till en segelbåt, utan segelbåt, för att förenkla det något.

Eftersom detta ytterligare är mer komplicerat så kanske det vore på sin plats att självstyrelsepolitiska nämnden i det här skedet åtminstone yttrade sig över frågan.

 Talman! Jag vill föreslå, lika som jag gjorde i det andra ärendet, att lagtinget samtidigt beslutar att begära ett yttrande från självstyrelsepolitiska nämnden. Eftersom nämnden nu har bekantat sig med den här problematiken så har de färsk erfarenhet av det, ett parallell fall.

Ltl Katrin Sjögren, replik

Talman! Det är en regim som fungerar mycket bra. Jag tycker att lag- och kulturutskottet har ett bra samarbete med självstyrelsepolitiska nämnden. Jag ser frågan som självklar.

Ltl Danne Sundman, replik

Det låter bra det, fru talman. Om någon har vänligheten att understöda mitt förslag i ett anförande så blir det verklighet.

Talmannen

Replikskiftet är avslutat.

Ltl Gunnar Jansson

När självstyrelsepolitiska nämndens viceordförande föreslår någonting så här konstruktivt så understöder jag hans förslag.

Talmannen

Begärs ytterligare ordet? Diskussionen är avslutad.

Kan förslaget att remittera ärendet till lag- och kulturutskottet omfattas? Förslaget är omfattat.

Ltl Danne Sundman, understödd av ltl Gunnar Jansson, har föreslagit att ett utlåtande ska begäras av självstyrelsepolitiska nämnden. Kan lagtinget godkänna det? Omfattat enhälligt. Ärendet remitteras till lag- och kulturutskottet som i sin tur begär ett utlåtande från självstyrelsepolitiska nämnden.

Andra behandling

4        Ett ramverk för införande av intelligenta vägtrafiksystem

Finans- och näringsutskottets betänkande (FNU 13/2012-2013)

Landskapsregeringens lagförslag (LF 9/2012-2013)

Först tillåts diskussion och efter det föreläggs lagförslaget för antagande.

Diskussion. Ingen diskussion.

Förslaget till landskapslag om tillämpning på Åland av 1 a kap. vägtrafiklagen föreläggs för antagande i andra behandling. Begärs ordet?

Lagtinget har i andra behandling antagit lagförslaget. Lagförslagets andra behandling är avslutad.

Betänkandets motivering föreläggs för enda behandling. Diskussion. Ingen diskussion. Lagtinget har i enda behandling godkänt motiveringen.

Ärendet är slutbehandlat.

Första behandling efter bordläggning

5        Ny polislag

Lag- och kulturutskottets betänkande (LKU 6/2012-2013)

Landskapsregeringens lagförslag (LF 3/2012-2013)

Ärendet bordlades 25.03.2013.

Först tillåts diskussion och efter det börjar detaljbehandlingen av de lagförslag som ingår i betänkandet.

Diskussion.

Ltl Axel Jonsson

Tack, fru talman! Jag har haft nöjet att få delta i utskottsbehandlingen av det här ärendet. Det har varit intressant, men inte alls okomplicerat.

Hur sköts och styrs egentligen en polismyndighet bäst? Är det en chefsledd myndighet eller en styrelseledd myndighet som är den bästa lösningen? Detta är en fråga som har uppehållit mig under den här behandlingen och som har gett mig delvis lite huvudbry. För lösningen vi har på vårt bord idag är nämligen en kombination av de båda kan man säga. Polisen styrs av en styrelse och leds av en polismästare, men när det gäller operativa frågor så styr även polismästaren. Så man förstår att förhållandet mellan styrelsen, landskapsregeringen och polismästaren är lite invecklat. Det finns inte någon tydlig hierarki, den är lite delad. Vad är då skillnaden mellan att styra och leda? Som ni säkert förstår så finns det inget entydigt svar på den frågan. Problematiken har konkretiserats synnerligen väl i Sverige, som fram till nu har haft polisstyrelser som i stor grad liknar den som nu föreslås för vår myndighet. Där är man mitt inne i en omorganisering som medför att de frångår modellen med styrelseledda myndigheter och övergår till chefsledda myndigheter. En stor bakomliggande orsak till detta är problemet att klargöra ansvarsfördelningen mellan styrelsen och polischefen.

Utskottet har fått erfara att skillnaderna mellan hur styrelsearbetet har fungerat har varierat stort i Sverige. I betänkandet skriver vi så här om vår bild av de svenska polisstyrelserna: ”Kommittén konstaterar att polisstyrelserna, vars formella uppgifter är att fatta beslut om budget och verksamhetsplan samt att höras i frågor av större vikt, i teorin har relativt omfattande befogenheter som dock i praktiken utnyttjas i en relativt liten grad.”

Är det då verkligen smart att övergå till en styrelseledd myndighet, med tanke på erfarenheterna i vårt västra grannland? Jag måste ärligt medge att jag inte har haft särdeles lätt att hitta svaret på den frågan. Hade inte Ålands Framtid lagtingsgrupp haft optimistiska anlag så hade ni förmodligen fått ett förslag till förkastande av lagen idag. Men det i teorin optimala sättet att utöva den politiska styrningen över polismyndigheten vore en stark ledning, från landskapsregeringens sida, med tydliga övergripande prioriteringar och en klar och informativ dialog med polismästaren. Detta utan en styrelse, det hävdar jag.

Tyvärr har vi ju sett att vi inte lyckats särskilt väl med när vi tidigare har arbetat efter den målsättningen. Om det beror på svagt ledarskap från landskapsregeringens sida, vilket jag personligen tror, eller personrelationerna mellan centrala tjänstemän och politiker, organisationens struktur eller någonting annat är nog en ganska mångfasetterad fråga. Men hur som haver så har den politiska styrningen inte fungerat som den ska göra.

Det är också därför som vi i Ålands Framtid väljer den föreslagna linjen med en polisstyrelse. Vi vill dock strängt poängtera att för att styrelsearbetet ska lyckas så krävs att landskapsregeringen utser en styrelse med politisk tyngd och kompetens. Erfarenheterna från Sverige visar, trots flera problematiska fall, några positiva exempel där styrelsearbetet har varit lyckat. Enligt utredningen som ligger till grund för polisreformen i Sverige och enligt hörandet i utskottet, har nyckelfaktorer i de goda fallen varit starka lokalpolitiker som gett kontinuitet i styrelsen. Landskapsregeringen har därför ett stort ansvar vid tillsättandet av styrelsen, för om reformen vi har på vårt bord ska bli lyckad eller inte så krävs just det ovannämnda. Det är också viktigt att styrelsen i praktiken utnyttjar de formella befogenheterna man nu får i lagen, så att det inte går som det har gått på flera håll i Sverige, att polisstyrelsen blir en ny polisdelegation eller en gummistämpel.

Ett studiebesök till en tidigare framgångsrik polisstyrelse i Sverige vore därför på sin plats för vår nya polisstyrelse, när den tillsätts, så att man ifrån början kan sätta fingret på andras framgångsrika arbetssätt och metoder. Egentligen är det ganska logiskt; ett bra styrelsearbete fordrar bra styrelseledamöter. Det är viktigt att komma ihåg i sammanhanget.

Vad gäller landshövdingens roll så har jag i en reservation motsatt mig att landshövdingen överhuvudtaget skulle tillmätas någon större eller mindre roll vad gäller polisstyrelsens arbete. Vi kunde i remissdebatten till den här lagen höra ltl Harry Jansson uttrycka: ”Det är mycket möjligt att man kunde lösa det här mycket smidigt t.ex. genom att i det kommande reglementet, som ska antas av den nya polisstyrelsen, ge landshövdingen en möjlighet att närvara vid polisstyrelsens sammanträden. Vi skulle vinna på det.”

Det här är något som också har smugit sig in i utskottsbetänkande som jag och vi i Ålands Framtid inte kan skriva under på. Vi menar att styrelsen för en åländsk myndighet inte behöver bakbindas av ett reglemente för att samarbeta med riksmyndigheterna på det här sättet. Ska vi få en fungerande styrelse bör den ha det förtroendet från lagtinget att självständigt kunna fatta beslut om när landshövdingen eventuellt tillför något i arbetet eller inte.

Min kollega, ltl Anders Eriksson, förde i debatten förra veckan fram en synnerligen relevant jämförelse med den färöiska inställningen i liknande frågor, vilket är värt att nämna i sammanhanget. Vi borde tänka på det oftare när vi diskuterar den här typen av symbolfrågor för självstyrelsen.

En annan symbolfråga är styrelsens språkskyddande uppgift. När jag lyssnade på debatten noterade jag att man tog upp om det var lämpligt att ge styrelsen i uppdrag att se till att polisens verksamhet till alla delar fungerar på svenska.

I Ålands Framtid tycker vi, liksom utskottsordförande skriver i sin reservation, att det är en självklarhet att verksamheten ska fungera på svenska, direkt härledd ur självstyrelselagen. Vad som dock inte är en självklarhet är vem som har ansvaret att se till att det faktiskt fungerar. Eftersom ansvarsfördelningen mellan landskapsregeringen, polisstyrelsen och polismästaren är så pass öppen för tolkning så stöder vi i Ålands Framtid fult ut att man uttryckligen poängterar detta ansvar för styrelsen. Enligt förslaget kommer det inte att vara möjligt att komma undan om självstyrelselagens språkkrav inte efterlevs. Delat ansvar är inget ansvar, brukar ltl Gunnar Jansson säga. Jag menar att så är det även i det här fallet. Därför är det synnerligen positivt att ansvaret för verksamhetsspråket avgränsas till styrelsen i en annars ganska svårtolkad ansvarsfördelning. Tack.

Ltl Åke Mattsson, replik

Tack, fru talman! Det är bra att ltl Jonsson har gjort en analys av polisstyrelsen. Omorganisationen i Sverige förvånar mig lite. Det kan också finnas andra orsaker bakom det. Ser man på organisationen i Sverige så har man övergripande tak och flera hierarkier. Man har rikspolisstyrelsen, man har länsstyrelser och man har också länspolismästare. Sedan kommer man ner på polismästare som vi har motsvarande här på Åland. Man ger alldeles för mycket makt åt en enda person. Polismästaren ska hantera alla utbildningsfrågor, alla övriga frågor och vilka dokument som ska godkännas. Det behöver finnas en mellanform och en polisstyrelse är kanske den rätta formen. Jag tycker att ltl Jonsson har gjort en bra analys. Jag ger mitt fulla understöd till att oavsett vilken organisation man gör så om man sätter fel personer dit så kommer det inte att fungera. Personerna är väldigt centrala här.

Ltl Axel Jonsson, replik

Självklart, i ett land som Sverige, med 9 miljoner invånare, så skiljer sig strukturerna lite från vårt samhälle här. Men det betyder inte att vi inte kan dra lärdom av de strukturer som har funnits där. Det finns säkert mycket information och mycket vi kan lära av de små polisdistrikten med sina styrelser. Jag vill poängtera att vi också ska utnyttja det när vi nu utformar en organisation som har stora likheter med de tidigare polisstyrelserna i Sverige. Det vore väl dumt att inte göra det. Jag uppfattar att ltl Mattsson och jag är överens där.

Ltl Åke Mattsson, replik

Fru talman! Ja, där är vi helt överens. Man ska ta erfarenheter och kunskaper från Sverige.

En annan fråga är språket. Jag är själv lite skeptisk. När man skriver i tid och otid i våra egna lagar att språket ska vara svenska så urholkar man självstyrelselagen lite. Det kan ju också vara befogat att man trycker på det. För det är ju väldigt viktigt att poliserna har svenska som arbetsspråk, att man får tillgång till dokument på svenska och framförallt att man får utbildning på svenska, så att det inte blir ett A-lag och B-lag. De som är tvåspråkiga och kan bra finska kan gå i finsk utbildning medan de övriga får stanna kvar i hierarkin. Myndigheten och styrelsen kan trycka på att det är svenska som ska gälla och det är viktigt att man lyfter den frågan i tid och otid.

Ltl Axel Jonsson, replik

Ja, det är mycket riktigt, men jag tycker att man också måste läsa den lagparagraf som reglerar styrelsens ansvar och uppgifter, som det står i lagen. Det är detta man reglerar i den här paragrafen och det är också där man säger att det är styrelsens ansvar och uppgifter att se till verksamhetsspråket fungerar på svenska. Det handlar inte om någon slags tolkning av självstyrelselagen, utan det handlar om ett direkt förmedlat uppdrag, som följd av självstyrelselagen. Det är ansvarsfördelningen som är det viktiga i det här sammanhanget vill jag åter poängtera. Visst ska vi upprätthålla dess status men jag ser inte att vi urholkar självstyrelselagen genom en sådan här skrivning. Tvärtom, vi förtydligar vem som faktiskt har ansvar att se till att den följs. Det är bra.

Talmannen

Replikskiftet är avslutat.

Minister Gun-Mari Lindholm, replik

Talman! Jag delar inte den här uppfattningen och de åsikter som ltl Axel Jonsson framför bl.a. när det gäller språkregleringen i lagstiftning och inte heller vad gäller den politiska styrningen.

Jag kan hålla med om att under perioder har det varit order och kontraorder ifrån politiskt håll, särskilt under de förra mandatperioden har jag förstått, när det gäller polisens verksamhet och den politiska styrningen.

Det skulle vara intressant att höra ledamoten konkretisera sitt uttalande när det gäller den politiska styrningen som inte har fungerat.

Ltl Axel Jonsson, replik

Jag har uppfattat att huvudorsaken för att man tillsätter en styrelse är att man i närmare dialog med polismyndigheten ska kunna ge kvantitativa mål för polismyndigheten i större utsträckning och med lite mera precision. Det talar väl för sig för att styrningen har varit bristfällig. Jag tycker att det kan man öppet erkänna från landskapsregeringens sida, även från tidigare landskapsregeringars sida, att det här är ett sätt att försöka få en bättre styrning på polismyndigheten. Det i sig säger väl att det finns ett sådant behov, annars är lagstiftningen totalt onödig.

Minister Gun-Mari Lindholm, replik

Talman! Jag förstår att ltl Axel Jonsson inte förstår den hierarkiska tågordningen när det gäller ministerns arbete eller andra politikers inblandning i polisens verksamhet och framförallt i den operativa delen. Till den delen det gäller att man har ett ramverk, budget och verksamhetsplanering, så har det inte fungerat under många, många år inom polisverksamheten. Jag ser nog styrelsen som länken mellan framförallt ministern, landskapsregeringen och lagtinget. Det är alldeles nödvändigt att man har det så. Det ska inte vara så att det är en minister som styr polisverksamheten. Jag tycker att det är väldigt, väldigt bra att det blir en styrelse. Polisdelegationen, som tidigare har varit verksam, har inte haft den befogenheten.

Ltl Axel Jonsson, replik

Nu vet jag inte huruvida ministern har utövat styrning över polismyndigheten tidigare, om hon själv har fattat alla beslut eller om hon har rådslagit med sina kollegor och i sista lagtinget hur den politiska styrningen ska ske över polismyndigheten och hur det har fungerat. Jag tycker ändå att argumentet att tillsätta en styrelse, för att man ska komma bort ifrån det här, talar väl för att det har funnits brister. Nog tillsätter vi väl ändå en polisstyrelse för att kunna öka styrningen och mera i detalj kunna styra polismyndigheten, annars finns det inget som helst som talar för att vi behöver den här lagstiftningen som vi har på bordet idag. Det är precis därför som vi har den här lagstiftningen och det är precis därför som vi ska ha den.

Talmannen

Replikskiftet är avslutat.

Ltl Harry Jansson, replik

Ltl Axel Jonssons uttalanden från talarstolen idag är lika obegripliga som hans reservation bifogat till lag- och kulturutskottets betänkande i den här frågan. I reservationen skriver ledamoten att han motsätter sig att landshövdingen skulle ha en central funktion i den nya polisstyrelsen. Sedan pratade han idag om att utskottet vill bakbinda den nya styrelsen. På inget sätt binder utskottets skrivningar den kommande polisstyrelsen. Man avgör fritt om och när landshövdingen närvarar. Som jag redan konstaterade under den inledande debatten förra veckan så är det en överdrift att påstå att det är en central funktion. Det är ju inte utskottet som har förverkligat det nuvarande systemet där landshövdingen har en central roll via en överenskommelseförordning etc.

Ltl Axel Jonsson, replik

Jag ska återigen påminna ltl Harry Jansson om vad han sade i remissdebatten när vi behandlade den här lagen: ”Det är mycket möjligt att man kunde lösa det här mycket smidigt, t.ex. genom att i det kommande reglementet, som ska antas av den nya polisstyrelsen, ge landshövdingen möjlighet att närvara vid polisstyrelsens sammanträden.” Ltl Harry Jansson föreslår alltså att man i ett reglemente skulle ge landshövdingen närvarorätt. Om inte det här är att ge landshövdingen en central roll i arbetet så vet inte jag vad det är? Uppmuntrar man landshövdingen att få någon slags närvarorätt eller att han ska ha en funktion i styrelsearbetet för en åländsk myndighet så säger åtminstone min ryggrad att då är vi på vills vad gäller självstyrelsen och våra myndigheter. Vi ska kunna sköta det själva så långt som möjligt. Om styrelsen finner att det finns ett behov så må man väl kontakta landshövdingen. Vi behöver väl inte uppmuntra det härifrån talarstolen.

Ltl Harry Jansson, replik

Jag är åter imponerad över att ledamoten har lagt ner energi på att reda ut vad jag har sagt i den här frågan. Nu vet ltl Axel Jonsson, trots sin unga ålder, att ett lagarbete förekommer inom utskotten. Vi kompromissar oss fram, vi får reda på nya fakta och utgående ifrån det tar utskotten ställning. Om vi skulle bakbindas hela tiden, när det gäller vad vi har sagt under en frågas inledande skede, så skulle det bli ganska svårt för oss att bedriva politik.

Återigen, vi ger inte landshövdingen någon central funktion i den nya polisstyrelsen. Vi ger polisstyrelsen fria händer att, när behov finns, bjuda in landshövdingen. Jag uppmanar ltl Axel Jonsson att inte gå i den fällan att se landshövdingsämbetet som en motståndare, en fiende till Ålands självstyrelse. Landshövdingsämbetet har visat sig spela en stor roll för Ålands utveckling och i synnerhet när det gäller den nuvarande innehavaren av ämbetet.

Ltl Axel Jonsson, replik

Det man ställer sig skeptisk till är syftet med den här skrivningen i utskottets betänkande. Från början föreslår man från centerhåll att landshövdingen i reglementet ska få närvarorätt och sedan lite senare så backar man och säger; ”nej, det räcker med att man uppmuntrar styrelsen till att föra dialog med landshövdingen”. Som oppositionspolitiker funderar man nog då vad syftet med den här skrivningen är. Vi motsätter oss ett sådant syfte att landshövdingen ska ha en funktion i styrelsen. Vi tycker inte att det är relevant i sammanhanget. Det finns så många styrelser där landshövdingen skulle kunna bidra med sin kunskap och sin person. Jag ser inte att landshövdingen, med sin position i det åländska samhället, har en funktion i den åländska polisstyrelsen. Vi kan ha olika åsikter. Jag respekterar ltl Harry Jansson för det, men jag tycker inte att landshövdingen ska in och rota i självstyrelsens interna organ.

Talmannen

Replikskiftet är avslutat.

Ltl Danne Sundman, replik

Fru talman! Jag tror, tvärtemot ltl Jonsson, att det sätt man nu har organiserat polismyndigheten med en styrelse med de här uppgifterna utgör ett bra och behövligt gränssnitt mellan landskapsregeringen och Ålands polismyndighet, med membran åt båda håll. Hittills har det inte fungerat med en tandlös delegation. Det behövs en mera handfast styrelse. Jag tror att detta är en mycket bra lösning som kan rätta till situationen som uppenbarligen inte har fungerat.

Ltl Axel Jonsson, replik

Ltl Sundman och jag är helt överens om att det inte har fungerat och därför behövs det ett skifte vad gäller systemet. När ltl Sundman säger att styrelsen behövs som en mellanhand eller någonting mittemellan polisstyrelsen och landskapsregeringen så är det precis där som problemet har varit. Kommunikationen har inte fungerat mellan de båda sidorna; mellan landskapsregeringen och polismyndigheten. Det är ju därför som vi tyvärr behöver en polisstyrelse, om man får uttrycka det så, för att vi ska få det fungera. Nog måste man ju ändå hålla med om att det optimala vore att landskapsregeringen direkt skulle kunna förmedla sin politik med raka rör, såsom man väljer att göra i Sverige idag, ner till polisens organisation och förverkliga sin politik och sina mål. Men tyvärr har det inte fungerat, vi får prova en ny metod och se om vi lyckas med det.

Ltl Danne Sundman, replik

Fru talman! Jag delar inte Ålands Framtids modell att en minister ska peka med hela handen, det är samma sak i ÅHS, ministern ska sitta med och vara allena saliggörande. Tvärtom, nu kan man ha en tydlig politik från landskapsregeringens sida som polisstyrelsen sedan genomför i samarbete med polismästaren och myndigheten som helhet. Snarare blir polisstyrelsen en förlängd arm in i myndigheten och knyter ihop de här, alltså ett gränssnitt mellan myndighet och vi här i landskapsregeringen och ytterst lagtinget som sätter målen i budgeten.

När det gäller språket så behöver det fokuseras på det svenska språket. Grejen är att det kommer att kosta att fungera på svenska. Det kommer att kosta att få gränssnitt i datasystem på svenska, till viss del inom utbildning och att få dokument översatta osv. Den där kostnaden måste man vara beredd att ta ifrån självstyrelsens sida. Kostnaden kan inte finansieras genom att prioritera ner polisverksamheten. Det här är också en typisk sak som polisstyrelsen kan göra övervägningar inom.

Ltl Axel Jonsson, replik

Ltl Sundman menar att styrelsen ska bli regeringens förlängda arm in i polismyndigheten, ja, det är väl så det blir. Nog har jag svårt att tänka mig att i de bästa av världar så är det den bästa lösningen. Landskapsregeringen har i uppdrag av lagtinget att förverkliga majoritetens politik. Varför behöver landskapsregeringen en förlängd arm när man har en polischef som kan förverkliga det som landskapsregeringen beställer? Det är ju så som det borde fungera.

Ltl Sundman och jag får vara överens om att det tyvärr inte har fungerat. En polisstyrelse kan vara ett sätt att förbättra den här kommunikationen, men en styrelse borde inte behövas, det hävdar jag bestämt, men tyvärr gör den det.

Talmannen

Replikskiftena är avslutade.

Ltl Wille Valve

Fru talman! Lag- och kulturutskottet har arbetat mycket med detta lagförslag, lagt ner många timmar och ett studiebesök på ett av Ålands viktigaste behörighetsområden: Allmän ordning och säkerhet. För oss moderater är detta en viktig behörighet, som har betydelse för det åländska samhället.

Låt oss börja med lite paragrafrytteri. Allmän ordning och säkerhet hör enligt självstyrelselagens18 § 6 till Åland. Det begränsas endast av 27 § 27 (skjutvapen och skjutförnödenheter), 34 mom. (försvarsväsendet och gränsbevakningen med beaktande av vad som stadgas i 12 §, ordningsmaktens verksamhet för tryggande av statens säkerhet, försvarstillstånd, beredskap inför undantagsförhållanden) och 35 mom. (explosiva ämnen till den del rikets säkerhet berörs). Resten hör enligt självstyrelselagen till Åland – och det är rätt mycket.

Hur var det då med förundersökning och tvångsmedel då? Om vi läser självstyrelselagen, så hör förvisso förundersökning till rikets behörighet. Men enda stället ”tvångsmedel” nämns i självstyrelselagen är, intressant nog, 19 § 26 mom. där det står att det hör till landskapets behörighet: ”Utsättande och utdömande av vite samt användning av andra tvångsmedel inom rättsområden som hör till landskapets lagstiftningsbehörighet”. Det är inte heller nödvändigtvis så enkelt som att konstatera att riksbehörigheten ”administrativa ingrepp” i den personliga friheten i 27 § 24 mom. automatiskt innebär att all tvångsmedel hör till Finland, utan riksbehörigheten över tvångsmedel anses flyta ut ur straff- och processrättsliga frågor, vilka faller under rikets behörighet enligt 27 § 1, 22-24 samt 42 punkten självstyrelselagen. Den uppmärksamma och kritiske lyssnaren kan notera att den sista punkten är den berömda ”slasktrattsparagrafen” – ” övriga angelägenheter som enligt grundsatserna i denna lag skall hänföras till rikets lagstiftningsbehörighet.”

 Men trots dessa två inskränkningar – den explicit uttalade om förundersökning och den något mindre uttalade om tvångsmedel, så hör alltså resten till åländsk behörighet. Och dessa två poänger är vad paragrafrytteriet utmynnar i: 1) Jag tror vi ibland tenderar att glömma bort hur vidsträckt vår behörighet egentligen är på detta område. 2) Uniformer och emblem är viktiga. Men vi ska inte glömma bort det som finns och bör finnas innanför uniformen: En god kännedom om vilka lagar som ska tillämpas inom områden med åländsk, riks- och blandad behörighet. Inom detta område tenderar vi ofta att fokusera på formerna, medan polismyndigheten själv gärna framhåller innehållet i sin verksamhet.

Utskottet går på landskapsregeringens linje i fråga om lagstiftningstekniken, ingen blankettlag utan fulltextlag. Detta motiveras uttryckligen med den centrala ställning som den egna poliskåren och den åländska behörigheten över allmän ordning och säkerhet intar i den åländska självstyrelsen – men också till viss del av överskådlighet. Det som styr den åländska polisens verksamhet ska finnas i samma lag. Liberalerna har reserverat sig och vill se en tudelning i en blankettlag samt en polisförvaltningslag. Jag tänkte inte alls racka ner på liberalernas reservation, bara lakoniskt konstatera att varje lagstiftningsteknik har sina nackdelar. Nackdelen med blankettlag är att vi de facto, om inte de jure, lämnar ifrån oss behörighet till riket över ett viktigt område. Å andra sidan: Nackdelen med fulltextlagen är att den måste uppdateras kontinuerligt, hela tiden. Rikets polislag landade i Finlands riksdag bara för några veckor sedan – nu gäller det att vi följer med vilka kompletteringar denna process utmynnar i och sedan tar ställning till dem.

Polislagen är dock ett sällsynt tydligt exempel på hur knepigt det kan vara att veta vad som gäller i vårt landskap. Lagberedningen publicerar vart fjärde år lagboken i PDF-format. Den som vill titta i polislagen hittar den inte i senaste lagbok från 2012 eller på lagtingets hemsida, utan enbart på landskapsregeringens hemsida i kronologisk ordning och PDF-format. Om man orkar vänta så kommer polislagen i 2016 års PDF-fil då det blir dags att ändra polislagen igen. Jämför detta med att gå in på FINLEX, klicka i rutan för ”gällande lagstiftning” och söka.

Lag- och kulturutskottet förenar sig idag med den ståndpunkt som finans- och näringsutskottet tidigare omfattat, dvs. att det finns ett behov av en kontinuerligt uppdaterad lagbok på Internet, ett ”ÅLEX”. Att åländsk lagstiftning är överskådlig handlar ytterst om hela lagstiftningens legitimitet hos den enskilde ålänningen. Utskottet vill därför framhålla att detta bör vara en beståndsdel i den digitala agenda som landskapsregeringen nu börjar förverkliga. 

Landskapslagen om Ålands polismyndighet kommer att innehålla en bestämmelse som slår fast att till ”Styrelsens ansvar uppgifter” hör att ”se till att alla delar av verksamheten fungerar på svenska”. Detta innebär inte en duplicering av självstyrelselagens art. 36 och 38 där det står att ämbetsspråket i landskapsmyndigheter är svenska – möjligen kan man se den som lex specialis av självstyrelselagens § 36 och § 38, då den specificerar att det är en av styrelsens uppgifter att tillse att verksamheten fungerar på svenska. På rent praktisk nivå, i det operativa polisarbetet bör det betraktas en styrka att kunna flera språk. En annan sak är att ÅPM är en myndighet som ska fungera på svenska, att alla officiella kontakter i enlighet med självstyrelselagens 36 och 38 ska ske på svenska – och att lagen specificerar vem som har tillsynsansvar för detta.

För polisstyrelsens del har utskottet också infört några andra preciseringar, framförallt att styrelsen skall ”besluta om” polismyndighetens budget samt verksamhetsmål. I övrigt inga större förändringar där.

Ekonomiska verkningar, då? Skapandet av ett nytt polisorgan kommer att medföra en något utökad byråkrati, men någon stor byråkrati torde inte vara frågan om – och inga stora resurstillskott som behövs för att polisstyrelsen ska kunna inleda sitt arbete.

Avslutningsvis har lag- och kulturutskottet har också tagit sig an att besvara frågan om vem som kan begära militär handräckning i nödsituationer på Åland: Beslut om begäran enligt 31 § självstyrelselagen ska fattas av landskapsregeringen och någon fullmakt för polisen att begära handräckning finns inte i den föreslagna polislagen vilket utskottet finner ändamålsenligt.” Detta är inga abstrakta saker – vem är det som begär handräckning i fall att en storolycka i stil med Estonia hotar Åland? Det är landskapsregeringen och det bör så vara, är utskottets svar. Denna fråga lär landskapsregeringen säkerligen återkomma till i andra sammanhang.

Moderata lagtingsgruppen stöder att denna lag antas till synes med ett undantag.

Ltl Katrin Sjögren

Talman! Landskapet står i beråd att få en modern polislag. Lagen blir mer detaljerad. Polisens befogenheter blir exaktare och mera heltäckande. Det är viktiga frågor när det gäller medborgarna och deras rättsäkerhet.

Lag- och kulturutskottet har lyft viktiga frågor i sitt betänkande när det gäller den åländska polismyndigheten, bl.a. den nya styrelsen, hur föreskrifter och anvisningar ska handläggas och polisens visuella profil.

Fokus i debatten, efter diskussionerna i lagtinget, har blivit fel. Hela moderniseringen av polislagen hamnar i bakgrunden av att det har uttalats i plenum att det är slutsnackat på finska och det diskuteras färg och form på polisens uniformer och bilar. Det tycker vi från liberalernas sida är mycket synd. Vi vidhåller också vår åsikt att självstyrelselagen är tillräcklig och glasklar när det gäller det svenska språket. Självstyrelselagens 36 § stipulerar att ämbetsspråket i landskapet är svenska och 38 § stipulerar om skriftväxlingsspråket. Vi anser att det är fullt tillräckligt och att självstyrelselagen räcker som general norm.

Det finns dessutom ett ansvar inom landskapsförvaltningen som bör tas och det är tillsyn och ledning.

Liberalerna lägger därför ett ändringsförslag där vi föreslår, i 1c §, styrelsens ansvar och uppgifter, att åttonde punkten utgår och man gör ett tillägg i ingressen i 1c §; ”styrelsen biträder polismästaren i myndighetens verksamhet enligt föreskrifterna i självstyrelselagen för Åland och i utvecklande mot det mål som lagtinget och landskapsregeringar satt upp för verksamheten.” Och så kommer uppgifterna för styrelsen enligt lagen. Tack.

    

Ltl Harry Jansson, replik

Tack, fru talman! Jag tycker det är synd att liberalerna invänder mot att lagtinget, som högsta ansvarig för självstyrelsens funktioner, skulle markera svenska språkets betydelse inom polisens verksamhet med de förgreningar det finns till både utbildning och annat där det finns ett samröre med finska staten. Jag tycker också det är synd att man även i den tidigare debatten jämfört polisstyrelsen på Åland med polisstyrelser i Sverige. Det är att blanda päron och äppel. En polisstyrelse här utgår ifrån vår egen lagstiftningsmakt, vår egen juristriktion och ska värna om de bitarna, där det svenska språket är en central del av verksamheten. Jag beklagar verkligen att liberalerna på det här sättet fronderar mot svenskheten.

Ltl Katrin Sjögren, replik

Talman! Det var kraftigt ord från ltl Harry Jansson. Liberalernas engagemang och kunskap om självstyrelsepolitiken är stadig och fast. Vi hävdar att självstyrelselagen är fullt tillräcklig för att uträtta det man vill ha gjort inom polismyndigheten. Självstyrelselagen är klar och tydlig.

Ltl Harry Jansson, replik

På vilket sätt skulle det då skada självstyrelsen och vårt vaktslående om svenska språket om vi ger en polisstyrelse ett uttryckligt uppdrag att i sin verksamhet värna om svenska språket i vardagen? Är det inte bra att det finns ett organ som bekymrar sig särskilt för polisens verksamhet i sin helhet? Tillgången på svenska i både utbildning och annat är ett viktigt inslag, det är därför som engagemanget med landshövdingen har dykt upp, för att kunna samverka på alla fronter. En polisstyrelse kommer årligen att beröra och även ta upp svenska språkets ställning inom polisens verksamhet. Det kan väl inte skada någon, utan enbart gagna helheten när det gäller att få vårt åländska samhälle att fungera på svenska.

Ltl Katrin Sjögren, replik

Talman! Om man anser att självstyrelselagen är fullt tillräcklig för att styra och leda Åland och underlydande myndigheter och landskapsförvaltningen så är man nog ute på sjufamnarsvatten. Blir det här legio när vi stiftar nya lagar, att vi påpekar att verksamheten ska fungera på svenska när det är självklart? Man kan inte vara helt enögd när man pratar om det svenska språket och det svenska språkets ställning på Åland. Man kan ha en glasklar åsikt, självstyrelselagen ska följas, men också hur man agerar utåt. Vi ser en svagare ställning från landskapsregeringens sida. Man ger utlåtande om propositioner som man tar på enskild föredragning. Det har varit legio och man har tagit beslutet i plenum i landskapsregeringen. Man behöver ha två ögon öppna när man pratar om det svenska språket.

Talmannen

Replikskiftet är avslutat.

Ltl Carita Nylund

Tack, fru talman! Jag ber om ursäkt om jag verkar ostrukturerad idag. Jag var lite oförberedd på att det här ärendet kom upp idag. Jag hoppas att ni förstår mina synpunkter i alla fall.

Som tidigare konstaterats så har det här varit en jättelång behandling. Det har varit en hel bunt med lagar som vi har gått igenom. Jag tror att det har varit 10-11 höranden i utskottet. Det har verkligen varit lärorikt och vi har fått mycket hjälp av våra höranden.

Det som mest har diskuterats är förstås den nya polisstyrelsens vara eller icke vara och utformning. Jag antar att styrelsens kompetens var upp till diskussion förra gången, när jag inte var här. Styrelsers kompetenser och kunskaper i olika landskapsägda bolag och myndigheter har under hösten diskuterats i andra sammanhang. Man kan ju bara konstatera att det är ju alltid lika viktigt, precis som i polisstyrelsen som i ÅHS eller vilken annan myndighet eller bolag som helst, att det finns en kompetens i styrelsen. Här har man också tydliggjort att det ska finnas en juridisk kompetens i styrelsen, vilket jag anser att är bra att man har beskrivit.

Det har också diskuterats huruvida landshövdingen ska kunna delta eller ha någon plats i styrelsen. Denna styrelses ledord kommer att behöva vara samarbete. Man ska jobba mot landskapsregeringen, man ska jobba mot polismästare, man ska jobba mot samarbetskommittén där landshövdingen har sin plats. Jag ser inga hinder för att man, i det här samarbetet med t.ex. landshövdingen, hör landshövdingen när man anser att det behövs. Jag tycker att skrivningen som vi har i vårt betänkande är bra. Det tydliggör något som kanske är självklart för många. (Det är lite mycket prat i salen, jag har svårt att koncentrerar mig när jag blir avbruten).

Man kan kanske tycka att det är självklart att man kan höra landshövdingen när man så tycker, men det gör ju ingenting att man förtydligar det i betänkandet.

Den delade behörigheten med Finland medför att det är ännu viktigare att vi faktiskt samarbetar med både samarbetskommittén, landshövdingen och andra representanter för den finska myndigheten.

Att landskapshövdingen ska ha en plats i styrelsen eller närvarorätt har jag inte ansett vara nödvändigt. Det är ju ganska självklart att en chef för en finsk myndighet inte ska sitta inne i en styrelse i en åländsk myndighet.

Det svenska språket har diskuterats. Jag förstår vad ltl Sjögren menar när hon säger att självstyrelselagens 36 § borde räcka för det här. Men det finns ju ingenting som hindrar att man tydliggör vems ansvar det är att självstyrelselagen följs. Det gör man ju här genom att beskriva att det är styrelsens ansvar. Vi har ju alla ett ansvar att följa lagen, men jag tycker att det är bra att man tydliggör det här.

De obundna hade ett ändringsförslag när det gäller den här lagen. Det handlar om 11 §; ”att landskapsregeringen genom landskapsförordning kan bestämma om polisens tjänstemärken, utseende på polisens fordon samt grafiska profil i övrigt.”

Detta var ungefär våra synpunkter, annars är vi alldeles nöjda och understöder den här framställningen. Tack.

Ltl Barbro Sundback

Fru talman! Det är hög tid att den här reformen nu genomförs. Under den förra mandatperioden hade vi en lång behandling av ett förslag där den förra regeringen försökte driva igenom en lagstiftning om en styrelse för polismyndigheten bland andra bestämmelser. Det misslyckades och den styrelsen hade en väldigt ovanlig sammansättning. Man föreslog, om jag inte minns fel, att ministern skulle sitta som ordförande. Ja, det var en mycket konstruerad styrelse, den skulle inte vara parlamentariskt tillsatt i första hand, utan på basen av några slags professionella egenskaper.

Bästa lagting, det här är en myndighet som lyder under landskapsregeringen, på samma sätt som ÅHS och Ålands gymnasium och ÅMHM. Vad är det som gör polisverksamheten så väldigt speciell? Det kan man fundera över. Vad är det som är så märkvärdigt med den här polisverksamheten så att den måste skötas på något annat sätt? Det finns inte någon jämställdhetsanalys på den grunden, men jag tror att det har någonting med det att göra.

Det har ständigt varit en massa åsikter som jag tycker att är ganska oväsentliga och känslosamma i det här ärendet.

Den här styrelsen är sammansatt enligt det som ltl Gun Carlson förespråkade under den förra mandatperioden och där jag ivrigt understödde hennes förslag. Det är väl i den här frågan, som i många andra, att bakom en massa män står det en hel del begåvade och förvånande kvinnor och undrar vad problemet egentligen är.

Nu har vi fått en helt normal styrelse med en politisk parlamentarisk representation som ska ansvara för den här verksamheten under mandatperioden.

Jag tror att det är väldigt viktigt att vi har flera politiska nivåer inom vår förvaltning, inte att ministrarna sitter direkt och styr nere i förvaltningen. Utan att jag har analyserat det helt så skulle jag höja ett varningens finger om man ser vad som sker norr om Mariehamn i en kommun. Där har man tagit bort en massa nämnder, man har försökt platta ihop organisationen, så de som sitter i det som man kan kalla för kommunstyrelsen är väldigt djupt nere inne i förvaltningen. Det finns alltså en tradition och en mening med att ha flera nivåer som delar makten. Makten blir mer och mer specialiserad ju längre ner man kommer och ju högre upp man kommer desto större är helhetsansvaret. Det där är väldigt viktigt att komma ihåg, annars blir det väldigt lätt oreda.

För socialdemokraterna är det inte något problem med det här styrelseförslaget. Vi hoppas nu att det kan godkännas så att det kan verkställas. Att sedan fördela ansvaret mellan polismästaren och styrelsen torde inte heller vara något större problem, så sker ju inom alla de övriga landskapsmyndigheterna.

Personligen tycker jag språkbestämmelsen är helt överflödig. Språkbestämmelsen kommer väl sig av en diskussion som har varit om att någon har pratat finska inom polisen. Då är det vissa som tycker att man måste göra någonting betydande och då skriver man in en sådan här bestämmelse. Frågan är om någon skulle prata finska där, vad händer då? Blir det några repressalier eller vad blir följden? Det står ju bara att man ska se till att alla delar av verksamheten fungerar på svenska och det är ju redan garanterat via självstyrelselagen, som många redan har sagt här. Jag ser det här mera som en politisk markering efter att saker och ting har skrivits i media.

Det finns en gammal parallell till det här som jag kom att tänka på. Det var när vi gjorde den första åländska barnomsorgslagen. Då hade det varit finska språkduschar i någon kommun. Det blev ett himla liv om det, för då höll barnen på ett förfinskas norr om Mariehamn och det var hot och fara å färde. Då skulle vi ha in i barnomsorgslagen att verksamheten skulle bedrivas enbart på svenska och så blev det. Det har väl varken gjort från eller till. Det blev slut på språkbadsduscharna. Om det var detta som var syftet så kan man väl säga att det lyckades den gången.

Vi får väl se hur det blir med det här. Jag tror inte att det finns någon orsak att bråka om det här. Det är samma resonemang som går igen, om och om igen; ska det finnas sådana bestämmelser i speciallagar eller är självstyrelselagen tillräcklig? I många lagar finns det inte. I de lagar som språkbestämmelser förekommer så finns det en tydlig koppling till en politisk debatt som har förekommit i media.

Fru talman! Frågan om landshövdingen har vi väl ventilerat tillräckligt. Jag tycker att det är mest förvånande att det här förslaget kommer från ltl Harry Jansson. Jag kan väl tänka mig att det har en personlig betydelse. Nuvarande landshövding har varit väldigt engagerad i de här frågorna och därför kan man tycka att det är värdefullt att ha honom med på styrelsemötena. Men så kan vi väl ändå inte riktigt lagstifta? Det måste nog grunda sig på lite mera generella principer. Lite märkligt tycker nog det är, för att inte säga lite, att statens högsta chef, en myndighetschef, skulle sitta i ett underordnat organ eller på något vis delta systematiskt i arbetet i en landskapsmyndighetsverksamhet. Det känns främmande, men jag kan förstå det utgående ifrån ett personligt omdöme.

Fru talman! I betänkande finns ett långt stycke om militären och militära ingripanden i relation till polislagen. Jag är lite förvånad över det här unga lagtingets intresse för armén, att vi plötsligt på Åland nu skulle ha blivit i så behov av att ordna upp de här relationerna så att vi i hotfulla situationer skulle kunna vända oss till den finländska armén. Nu har det ju klargjorts att det är regeringen som kontraktar armén. Man oroar sig tydligen för att det ska bli stora naturkatastrofer eller andra förfärligheter, terroristattacker och allt vad det kan finnas för hemskheter, och då ska finska armén kallas in för att hjälpa oss. Men det brukar vara så med armén att de måste träna väldigt mycket. De tränar för att det ska bli krig och de tränar för allt möjligt. Det blir inte så mycket krig längre här uppe i Norden och då vill de gärna också ha andra uppgifter för det finns en risk för att de förlorar hela jobbet. De har en policy att försöka utvidga sitt ansvarsområde och det må de väl göra. Men jag tycker inte att vi på Åland ska stå och ropa efter armén. Vi ska nog försöka stöda det civila samhället. Det var någon som nämnde Estoniakatastrofen här. Mitt minne är att Åland klarade sig alldeles utmärkt utan finska armén. Åland fick till och med ett stort beröm efteråt. Det civila samhället fungerade enormt effektivt, som det vanligtvis gör på öar omkring i världen, för man kan inte vänta sig att man ska få hjälp när det behövs snabbt. Man utvecklar en kultur där man lär sig att lita på varandra och man vet vem som har den och den grejen som berörs och telefonerna går heta. Man lyckas för det mesta klara av också betydande svårigheter.

Fru talman! Visst ska vi återkomma till de här frågorna i ett senare meddelande av regeringen. Jag är lite besviken över att det är det som man har saknat i lagstiftningen, som finns i rikslagstiftningen.

Ja, det är kanske dags för beslut. Jag vill gratulera regeringen till det här förslaget. Utskottet har säkert gjort många bra och viktiga förändringar. Nu skulle det vara väldigt bra att få beslut om det här. Tack.

Ltl Katrin Sjögren, replik

Talman! Först en kommentar till det tidigare förslaget till polisstyrelsen som förkastades. Där var det en annan regim. Man tänkte sig en polisstyrelse som inte var en del av polismyndigheten och som också kunde ha andra uppgifter t.ex. beträffande lotterilagstiftningen. Den här landskapsregeringen har ju helt och hållet ändrat regim och det kan vara viktigt att komma ihåg.

På samma vis som ltl Sundback funderade över tillsynen över svenska språket och vad som händer, blir det repressalier och reprimander, så skulle vi också vilja veta hur man tänker sig i fortsättningen? Kanske ministern svarar på frågan jag ser att hon har begärt ordet.

Ltl Barbro Sundback, replik

Tack, fru talman! Det är väl ingen idé att prata om den förra regimen. Det förslaget förföll ju helt och hållet. Det fanns inte majoritetsunderstöd för det förslaget. För mig var det en väldigt originell och apart lösning inom vår förvaltning, men det kanske fanns goda skäl för det.

Det här med repressalier, det är nog kanske lite retoriskt sagt. Det blir ju ingenting antagligen. Det är precis som ltl Wille Valve sade, det är ju bra att våra tjänstemän kan många språk. Det gör inte någon skillnad på det att vi har myndigheter som i sin verksamhet ska vara enspråkigt svenskt.

Talmannen

Replikskiftet är avslutat.

Ltl Wille Valve, replik

Tack, ltl Sundback, för det anförandet. Mitt unga minne till trots så är jag är relativt säker på att under Estoniaolyckan så hade vi arméhelikoptrar på Åland från både Finland och Sverige. De svenska helikoptrarna hade större utmaningar än vad de finländska hade, de gjorde vissa kompletteringar i helikoptrarna efter det. Jag delar inte ltl Sundbacks redogörelse av att ålänningarna skulle ha klarat sig utmärkt utan militär handräckning i den situationen.

Ltl Barbro Sundback, replik

Ja, det är möjligt att det var så. Jag ville säga att de civila samhällena på öar ofta är väldigt effektiva när det gäller att söka lösningar, också på större problem. Det är en kultur som vi ska värna om. Detta att kalla på militärer är att göra sig själv svag och att tro att militären alltid är stark och alltid vet. Jag tycker att historien vittnar om att det är få fall, om det ens finns något, där militären har lyckats särskilt bra.

Ltl Wille Valve, replik

Till den delen kan jag hålla med ltl Sundback, att betona styrkan som finns i det civila samhället och som vi aldrig ska underskatta.

Det knyter an till en annan diskussion som för övrigt är högaktuell; det nordiska militära samarbetet. Jag tror att det ligger i Ålands intresse att få in det försvars- och säkerhetspolitiska samarbetet på en så fredlig och konstruktiv bog som möjligt.

Talmannen

Replikskiftet är avslutat.

Ltl Gunnar Jansson, replik

Tack, fru talman! Kollegan Barbro Sundback ställer frågan om ansvar för bestämmelsen i polisförvaltningslagens 1c § 8, ”där styrelsen ska se till att alla delar av verksamheten fungerar på svenska”. Hon ställer frågan vem som bär ansvar och vad händer om det inte följs? Punkten är så olyckligt formulerad att det är styrelsen som bär ansvaret för det hela. Styrelsens medlemmar bär ansvar för att tillsynen fungerar. Det är som en tjänsteplikt, det är en offentlig maktutövning vi talar om och tjänstereglerna gäller också kollektivt i sådana här sammanhang. Den vanligaste brottsrubriceringen i tjänsteutövning är de så kallade underlåtenhetsbrotten. Det här är en uppenbar inbjudan till att styrelsens medlemmar kan underlåta att sköta sina förpliktelser och blir därmed ansvariga för påföljder.

Ltl Barbro Sundback, replik

Ja, om det bara var juridik som vi levde efter här i världen så skulle det säkert fungera så. I praktiken tror jag att den där bestämmelsen kommer att ha en ganska liten betydelse, den kommer antagligen inte att tillämpas mycket. Det kan man säkert vara upprörd över men jag tror faktiskt att vi har många sådana bestämmelser inom vår förvaltning.

Lagstiftningen är sedan normgivande och tjänstemännen följer den inte till punkt och pricka alla gånger.

Ltl Gunnar Jansson, replik

Min kommentar var juridisk därför att kollegan efterlyste ansvar. Ansvar i offentlig maktutövning handlar om juridik. Här i salen sysslar vi med politik, men i myndighetsutövning är det uttryckligen ett juridiskt ansvar vi hanterar, därför min kommentar.

I övrigt delar jag den uppfattningen om att det här är en liten fråga. Den är ju så liten så att vi föreslår att den här punkten ska strykas ur paragrafen och bäddas in i ett sammanhang där den hör hemma, dvs. i inledningen till paragrafer, som utskottsordförande Sjögren nämnde.

Ltl Barbro Sundback, replik

Min uppfattning är att den inte alls skulle ha behövts, som några har förespråkat här. Nu laboreras det med lite olika tekniska lösningar i den här frågan. Jag ser inte att det är någon väsentlig skillnad i det heller. Jag vill att vi ska få igenom lagstiftningen nu. Om det sedan visar sig nödvändigt i den här frågan så får man väl göra ändringar i kommande lagförslag.

Talmannen

Replikskiftena är avslutade.

Minister Gun-Mari Lindholm

Talman! Jag tycker att det är synd att just den här formuleringen om språkbestämmelsen i förvaltningslagens 1 § om polisverksamhet ska bli en fråga som antagligen blir föremål för en omröstning här i salen, eftersom liberalerna har valt att lämna in ett ändringsförslag. Jag tycker att det är synd att man gör det. Jag förstår att man har fångat upp de strömningar som finns både ute bland tjänstemän och i messaspalter och man ser att det här är en möjlig väg att gå fram. Jag tycker att det är synd, det borde vara så att vi samlar all den kraft vi har för att enas i de här frågorna. Det finns ingen annan verksamhet under självstyrelsen som har så delad behörighet som polisens verksamhet. Man kan fråga om den verksamheten egentligen överhuvudtaget är åländsk? Men, vi vet att det har varit problem att hålla den verksamheten helt hundraprocentig svenskspråkig. Det är ingen hemlighet att det fanns problem, det borde det inte heller vara för liberalerna som hade den är ministerportföljen för 1 1/2 år sedan, och som också ledde polisdelegationen. Hade man inte upptäckt det under den mandatperioden så hade man varit både döv och blind.

Jag tycker att det är synd att man inte med kraft kan enas om att man behöver arbeta för att det ska finnas en rättssäkerhet för samtliga som jobbar inom polisverksamheten så att inte yrkeskåren uppdelas i ett A- och B-lag beroende på om man kan finska eller om man enbart talar svenska. Jag hade hoppats på att man skulle samlas runt det i lagtinget. Jag tycker att det är synd att man delar upp den här frågan och den här för Åland så väsentliga grundpelaren.

När det gäller den politiska styrningen så vänder jag mig till Ålands Framtid. Jag tycker att det var lite avslöjande och lite chockerande, för mig i allafall, att höra Ålands Framtids partiordförandes uttalande. Man förespråkar en hierarkisk modell att husbonden bestämmer. Man vill inte ha en demokratisk organisation och en platt organisation. Man vill helst att en minister bestämmer rakt ner i verksamheten och det är för mig i alla fall chockerande. Jag har utgått ifrån, och jag har varit så naiv att jag har trott, att vi alla har haft samma demokratiska synsätt när det gäller att få en rättssäkerhet och när det gäller att få så bred beslutandenivå som möjligt. Men jag hör att Ålands Framtid däremot vill ha en minister som styr rakt ner till polismästare.

I det här lagförslaget är organisationen tänkt att vara som så att polismästaren föredrar för en polisstyrelse som i sin tur också har kontakt med tjänstemannen på rättsserviceenheten och som har kontakt med ministern, landskapsregeringen och som för förslaget till lagtinget för avgörande. Det är åtminstone i min demokratiska värld och synsätt det enda möjliga för att få den här bredden på besluten. Jag hör att Ålands Framtid hellre har en husbonde som bestämmer. Tack.

Ltl Katrin Sjögren, replik

Talman! Det är dags nu, minister Lindholm, att börja ta ansvar istället för att se bakåt. Inte är det synd om någon! Upprinnelsen till hela den här vulgärdebatten och förlöjligandet finns i majoritetsblocket att söka. Liberalerna lade i utskottsbehandlingen ett förslag om att ta bort åttonde punkten, men fick inget gehör. Vi företräder en linje.

Det jobbades mycket under den förra mandatperioden med polisen, med omstuvningar i tjänster, med personalenkäter och med ett förslag till styrelsen. Leverera nu, minister Lindholm!

Minister Gun-Mari Lindholm, replik

Talman! Ja, är inte det här ett bevis på leverans?

Jag började den här mandatperioden med att ha ett möte med poliserna. Jag sade att under den här mandatperioden så hoppas jag att kunna leverera, att ta ansvar för den här verksamheten som inte hade fått någon förnyelse under många, många år.

En ny lagstiftning, en ny struktur inom polisverksamheten, en ny organisation, tillämpningsanvisningar till lagstiftningen och ett nytt och modernt polishus. Alla de frågorna har jag tagit ansvar över och de är på banan allihop.

Ltl Katrin Sjögren, replik

Talman! Men är det inte synd då att hela polislagstiftningen blir en diskussion om färg och form på bilar och att det är slutsnackat på finska i polishuset. Jättesynd och fel fokus från majoritetsblocket!

Minister Gun-Mari Lindholm, replik

Talman! Mycket kan jag ta ansvar för men jag kan inte ta ansvar för den debatt som pågår i lagtinget. Jag tycker inte att ltl Sjögren eller liberalerna har försökt vända debatten till någonting annat heller.

Talmannen

Replikskiftet är avslutat.

Ltl Mats Perämaa, replik

Fru talman! Det var inte mycket till anförande det där. Gällande den delen att liberalerna har medverkat i debatten tidigare så gick ju ministerns anförande bara ut på att det är synd att inte liberalerna tycker likadant som ministern själv. Vad var det för ett anförande? Här fanns frågeställningarna om vad 1c § 8 p. riktigt innebär i praktisk utövning i polisiärt arbete ute på fältet, där polisen enbart kan prata svenska. Det är frågeställningar som vi behöver svar på, och inte föra en diskussion om vad som står i messaspalter. Anförande visade i varje fall att ministern följer nogsamt med vad som står i messaspalterna, ingenting annat.

Minister Gun-Mari Lindholm, replik

Talman! Ja, jag läser det mesta jag kommer över, även messaspalterna.

När det gäller tjänsteutövningen så är saken väldigt klar, är det så att man är tjänst så talar man svenska mellan tjänstemännen. Om det är så att en person som man träffar på gatan behöver hjälp så talar man det språket som man har gemensamt. Den tydliga signalen har också gått ut till verksamheten. Jag har varit på möte hos polisen så det här är ingenting som är obekant för myndigheten.

 Ltl Mats Perämaa, replik

Fru talman! Men det är inte ju inte det som står i den här lagparagrafen. Det står ju uttryckligen att verksamhetsspråket är svenska. Betyder inte det då att alla pratar svenska, punkt slut? Det är slutsnackat på finska.

Att sedan ministern går på ett möte med polisen för att försöka beskriva vad som så småningom kommer att stå i den blå boken så det är politik, det har inte riktigt samma värde ändå som det som lagtinget fattar beslut om uttryckligen i en lagparagraf som ska bli en åländsk lag.

Minister Gun-Mari Lindholm, replik

Jag vet inte riktigt vad liberalerna är ute efter? Är det så att man anser att myndighetsspråket är någonting annat än svenska? Det anser inte jag, det anser inte en majoritet i den här salen och det tycker jag att skulle vara väldigt väsentligt att veta. Däremot säger liberalerna att självstyrelselagen är tillräcklig, då är det samma sak i så fall, att myndighetsspråket är svenska.

Åtminstone som jag uppfattar liberalernas tankar så kanske det finns någonting annat som man avser med frågeställningen till mig om vad myndighetsspråket är. För mig är det helt solklart att man talar svenska inom myndigheten mellan tjänstemän, i kontakter med myndigheter till Finland osv. Men är det så att man har kontakt med någon ute på stan eller i andra sammanhang så talar man det språk som är möjligt att tala tillsammans.

Talmannen

Replikskiftet är avslutat.

Ltl Axel Jonsson, replik

Tack, fru talman! Ministern kritiserar Ålands Framtid för att vi inte vill ha en platt organisation. Nej, vi vill inte en platt organisation. Vi vill ha en tydlig styrd organisation som gör det som lagtinget efterfrågar i form av lagstiftning och som också riksdagen i Helsingfors efterfrågar i form av lagstiftning och som vi beslutar om i form av budget. Sen är det regeringens, och nu enligt det nya förslaget styrelsens, uppgift att verkställa det som beställs. Så långt är vi överens. Jag menar att man kan kritisera nuvarande regering och tidigare regeringars sätt att förverkliga den politik som har beställts från lagtinget. Man har inte haft den förmågan. Därför har vi nu ett förslag på en polisstyrelse som ska förbättra det här och se till att vi får en bättre polisorganisation som bättre svarar upp mot de mål som lagtinget och landskapsregeringen ställer.

Minister Gun-Mari Lindholm, replik

Det är lite svepande formuleringar som nog kräver konkretiseringar. Man säger att man inte har lyckats leverera. Då vill jag att ltl Axel Jonsson berättar vad det är som man inte har levererat som man har lovat?

Ltl Axel Jonsson, replik

Ett konkret exempel, eftersom det här verkar vara en ömmande punkt för ministern, är när vi fick en ny polismästare som anställdes efter prövotid. Där var det uppenbart att det var en minister som styrde det här beslutet och inte rådgjorde, såsom Ålands Framtid skulle ha gjort, med sina regeringspartier om det var ett bra beslut eller inte.

Vi förespråkar att regeringen som helhet ska förverkliga den politik som lagtinget beställer och inte fatta enskilda beslut. Det är ju då vi pratar om ministerstyre, men det är ju trevligt att ministern kritiserar oss och frågar efter modell som man självförverkligar. Det är klädsamt.

Minister Gun-Mari Lindholm, replik

Talman! Jag skrattade för att ltl Axel Jonsson är så tvärsäker på att minister Lindholm inte hare fört något samtal angående polismästarens fortsatta tjänstgöring eller inte. Jag kan övertyga ltl Axel Jonsson att den diskussionen har förekommit. Det var ett dåligt exempel för det var en felaktig konkretisering av det som inte har levererats. Det ska väl i så fall vara en leverans till lagtinget, om det är någonting som ska vara relevant. Jag kan alltså konstatera att det var mest tomt prat. Tack.

Talmannen

Replikskiftena är avslutade.

 Ltl Danne Sundman

Fru talman! Vi har upplevt två mycket initierade och kloka anförande från två kvinnor; en minister och en lagtingsledamot. Det som ltl Sundback sade i början var mycket klokt. Egentligen borde vi kanske alla ta ett djupt andetag och se det här som vilket ärende som helst. Det har blivit en väldigt tillspetsad debatt kring det här. Det kan förklaras med det att det berör mångas innersta känslor. Polismyndigheten är en viktig del, det är en av de finaste juvelerna i självstyrelsekronan. Men egentligen är det precis som Sundback säger, det är en verksamhet som vilken annan som helst, visserligen lite speciell men väldigt viktig.

Den organisationsmodell som man tar nu, så inte är det något speciellt med den. Tvärtom, den är vedertagen och beprövad och den anpassas något efter de behov som föreligger i det här fallet. Jag understöder ltl Sundbacks resonemang att det är bra med flera beslutsnivåer och att det är flera människor engagerade. Jag ska inte ta upp det exemplet som Sundback tog upp. Ett bra exempel på en helt annan nivå är att man har, som det var förr, att ministern handgripligen styr verksamheten själv, så det funkar inte på det viset i dagens demokratiska samhälle. Det är mycket bättre om de passerar fleras ögon och fleras hjärnor, om man har en polisstyrelse som kan engagera sig i just den verksamheten, i just den myndigheten, i just de problemen och de prioriteringarna och sedan förklara och utgöra ett gränssnitt mot den politiska makten. Polisstyrelsen ska förklara vilka polismyndighetens behov är och hur man ska försöka lösa problemen. Det är klart att föredra jämfört med att det är en person som möter en annan person och så blir det bara två personers show. Det här är som ÅMHM, som ltl Sundback nämnde. I myndigheten ÅMHM finns en styrelse. Den styrelsen har ingenting egentligen med den operativa verksamheten att göra, man får inte pröva ärenden osv. Det sköter tjänstemännen mot en nämnd eller mot enskild föredragning med sig själva.

ÅHS är en annan myndighet, inte är ju styrelsen med vid operationsbordet ”skär inte där utan skär lite längre till vänster ”. Läkarna sköter det, den operativa verksamheten är separat och man förlitar sig på läkarnas kunskap. Det här är också ett exempel, inte kommer polisstyrelsen att hålla i radarn och säga att nu kör du för fort och du får böter utan det gör polismännen och kvinnorna. Det här ett parallellfall till den snart ganska fina bukett av välskötta myndigheter och bolag som landskapet kan visa upp. Det här tror jag att blir väldigt bra.

Sedan ska man komma ihåg att hur detta sedan blir beror på hur styrelsen organiserar sig, vilka personer man lyckas rekrytera och hur man utformar reglemente osv. Ibland blir det rätt till direkt, ibland tar det en tid innan det finner sin form. Förhoppningsvis så blir det här bra direkt. Eftersom man har funderat på det här och tagit sats flera gånger, dragit tillbaka förslag och kommit med nya förbättrade förslag så blir det här riktigt bra. Det passar in i det sätt på vilket vi styr vårt landskap.

När det gäller det som ltl Sundback också mycket klokt sade att i de fall där det har funnits mycket problem så kommer det en politisk beställning för att förtydliga en lösning och det gör man också i den här paragrafen när det gäller språket hos polismyndigheten. Det finns ett problem, som alla upplever, och som man vill förtydliga, att det är styrelsens sak tillsammans med myndigheten se till att det här kommer på rätt. Om man pratar kring det lite så ska man komma ihåg att problemet är väldigt mångfacetterat. Det har delvis att göra med att man är väldigt nära knuten till polisen i Finland och tar del av polisen i Finlands olika dokument och register. För att bringa det här på rätt så krävs det, som jag sade i en replik här, att man förstår att det kräver resurser. De resurserna kan inte tas ifrån polisarbetet. Man kan inte sluta att vara ute med alkometern bara för att det måste fungera på svenska. Om vi ska få det att fungera på svenska så måste vi vara beredda att prioritera det och ge extra resurser för att reda upp det. De flesta saker gör man en gång men det finns också fortlöpande kostnader. Självstyrelsen kostar pengar, jämfört med att inte ha det. Svenska språket kostar pengar, vi måste komma ihåg det!

Som jag sade tidigare i en replik häromdagen så handlar det här med språket om att man från polismyndighetens sida vill göra rätt. Man upplever den här debatten som kritik mot sig själv, det tycker jag att är olyckligt och så vill jag inte se det. Man måste vända det så att man tillsammans måste lösa de här problemen och försöka få detta på rätt bog. En lämplig lösning är att polisstyrelsen tar sig an det här. Då kan också polisstyrelsen förklara åt landskapsregeringen vad som behövs. Polisstyrelsen kan noggrant tillsammans med tjänstemännen och myndigheten ta reda på vad som krävs för att det ska vara möjligt för myndigheten att fungera på svenska.

Jag vill också, likt Sundback, tona ner den här problematiken även om den får mig och min puls att öka så är det inte en lösning.

Som Sundblom sade när vi fick vår självstyrelse mot vår vilja; ”nu ska vi arbeta” och sedan dess har vi arbetat med svenska språket och ska fortsätta att arbeta med det.

Sedan vill jag, i likhet med tidigare talare minister Lindholm, uttrycka mig när det gäller liberalernas förslag, att jag tycker att det är tråkigt att man stryker just den meningen när man ger styrelsen det här ansvaret om språket. Det har vi, som sagt, i många andra lagstiftningar, det är ingenting konstigt och det devalverar absolut inte självstyrelselagens bestämmelser. Det är vanligt att man materialiserar självstyrelselagens bestämmelser i vanlig lagstiftning när det gäller svenska språket. Det finns ett otal exempel om ni läser lagboken.

Liberalerna däremot, som ministern mycket riktigt konstaterar, ser möjligheten nu att fiska i grumliga vatten, vilket det de facto handlar om när man föreslår det här. Man försöker profitera och slå politiskt mynt av de strömningar och de personer ute i samhället som kanske inte har den största förståelse för svenska språket och för Ålands språkliga ställning. Det finns ju personer som inte har den förståelsen, det är ingenting att hymla om, och det är heller ingenting att hymla om att det är fullt tillåtet att tycka så i ett demokratiskt system. Men jag tycker att det är tråkigt eftersom det blir en slags uppvigling. Det blir en slags uppvigling, det blir ett slags ”sälja morsan politik” och man gör vad som helst för att få folkets gunst. Tvärtom, vi ska se oss som opinionsbildare när det gäller självstyrelsens grundvärden. Vi har en roll att föra ut vad självstyrelsen är, varför vi har självstyrelse och varför Åland är enspråkigt svenskt och framförallt hur det ska vara i framtiden. Det är vi själva som i stor utsträckning bildar den opinionen. Då ska man inte göra som liberalerna har gjort nu. Det tycker jag inte om och det vill jag säga. Jag skulle inte ha begärt ordet annars, men det vill jag verkligen säga att det bjuder mig emot när man gör på det här viset.

Det handlar om att vi lagtingsledamöter har ett integrationspolitiskt ansvar att föra självstyrelsens grundvärderingar vidare till de nya ålänningarna som flyttar hit, även om deras uppfattningar är annorlunda så ska vi för diskussion och debatt i samhället. Och då ska vi inte försöka slå mynt och uppvigla för dem som inte förstår sig på självstyrelsen eller har en annan åsikt utan tvärtom, försöka enas och tillsammans försöka bära självstyrelsen. Detta tycker jag att är jätteviktigt.

 Ltl Katrin Sjögren, replik

Talman! Sin vana trogen förbehåller sig ltl Sundman rätten att avgöra vem som tänker rätt och vem som tänker klokt. Det var mycket skam och skuld i ltl Sundmans anförande. Liberalerna följer en linje. Vi tycker att självstyrelselagen är den viktigaste lagen i landskapet och den vill vi värna.

Ltl Danne Sundman, replik

Fru talman! I slutet av mitt anförande kanske det var lite skam och skuld, men huvudsakligen var det beröm till andra talare, till och med till kvinnliga talare som har sagt mycket kloka saker.

Det är ingenting nytt att liberalerna gör på det här viset. Jag har tidigare kritiserat liberalerna för det och också då har jag sagt att jag tycker att det är tråkigt. Jag tycker inte att det är någonting som man ska syssla med.

Samtidigt som jag säger att jag inte håller med så försvarar jag liberalernas möjligheter att ha den här åsikten. Men jag måste väl få säga att jag tycker att det är tråkigt.

Ltl Katrin Sjögren, replik

Talman! Var det en freudiansk felsägning det där? Till och med kvinnliga talare kan Sundman ge beröm till.

Liberalerna har en linje och vi förbehåller oss rätten att driva vår linje. Inte kan det väl vara på det viset att man blir så maktfullkomlig att det finns ett enda sätt att tänka? Då kan vi ju klappa ihop hela parlamentet direkt. Jag tycker nästan det är osmakligt.

Ltl Danne Sundman, replik

Fru talman! Nej, därför försöker jag säga att det finns flera sätt att tänka och hur vi borde tänka tillsammans. Jag är inte för att man ska ha monopol på sin åsikt. När det gäller självstyrelsens grundvärden så tycker jag att man ska ta sig an utmaningen att föra den vidare och förklara för nästa generation ålänningar och åt nya ålänningar som flyttar hit varför vi har självstyrelse och hur den ska förvaltas i framtiden. Jag tycker att vi lagtingsledamöter särskilt har det ansvaret. Alla ålänningar har det ansvaret, med hembygdsrätt kommer också hembygdsskyldighet.

Talmannen

Replikskiftet är avslutat.

Ltl Anders Eriksson, replik

Det här var ett anförande som jag hade lite svårt att följa med i. Jag förstod i varje fall att ltl Sundman sade att om en minister bestämmer så är det inte bra. Han nämnde att tack vare det här arbetet som har varit nu, att man knuffar ut allt mer av det politiska arbetet, så har man en bukett av välskötta myndigheter. Han nämnde ÅMHM som ett exempel. Det är sant, de som sitter i styrelsen vet egentligen ingenting om verksamheten och de har väldigt få möjligheter att påverka. Problemet är ju att det inte finns någon politisk styrning överhuvudtaget av den här verksamheten. Medborgare som känner att de blir felbehandlade i ÅMHM är ju mer eller mindre rättslösa. Jag tycker däremot att i ett modernt samhälle så borde man försöka ha så korta och tydliga beslutsgångar som möjligt. Av någon anledning skjuter landskapsregeringen över allt till myndigheterna och frånsäger sig allt mera ansvar och jag tror faktiskt inte det är bra.

Ltl Danne Sundman, replik

Fru talman! Jag tror tvärtom, att det är viktigt att frigöra ministrarnas tidsresurs till strategiskt tänkande och övergripande politiskt arbete istället för att vara ”superavdelningschefer” och vara ute och peta i verksamheten. Ministrarna ska jobba strategiskt, sätta upp strategiska mål, prioritera resurserna och föra många utvecklingssamtal. Sedan är det någon annan som ska göra det praktiska arbetet. Då är det alldeles utmärkt att det kommer en polisstyrelse som tillsammans med myndigheten och polismästaren kan utveckla Ålands polismyndighet.

Jag vet att ltl Anders Eriksson inte tycker om det här ”volleybollköpande” man vill ha ministrarna på strategisk nivå, men då måste man ta bort sådana här uppgifter och ersätta dem med andra system. Det har fungerat någorlunda bra i andra sammanhang.

Ltl Anders Eriksson, replik

Jag håller med om att det kanske har fungerat bra i andra sammanhang, men här fungerar det inte så speciellt bra. Ltl Sundman får gärna ge mig ett exempel på vilken typ av strategiskt arbete nuvarande landskapsregering har ägnat sig åt.

Tittar man igen på miljö- och hälsoskyddsmyndigheten, och det är inte deras fel, så för man över allt mera dit. Det finns de som säger att den myndigheten har blivit som en slasktratt, allt som man inte vet hur man ska hantera i landskapsförvaltningen så tar man över till miljö- och hälsoskyddsmyndigheten. Det är ett bekymmer att många landskapsverksamheter fungerar dåligt. Till och med inom näringsavdelningen, som jag tycker att fungerade väldigt bra tidigare, så kan det ta upp till ett halvår innan medborgare överhuvudtaget får ett svar. Det är en enda röra, allt är så tillkrånglat, det finns inte någon början eller någon ende. Problemet är ju att ingen är ansvarig för det mera. Det är klart att man inte behöver hårdra det och prata om ministerstyre, men jag tycker det är bra om ministern bestämmer, då vet man vem man ska byta ut om det inte fungerar. Nu vet ingen någonting om någonting.

Ltl Danne Sundman, replik

Fru talman! Det var väl en lite väl negativ replik. Det finns alltid saker att förbättra, både i myndigheter och i vår egen förvaltning. Men att måla upp en så nattsvart bild kanske ändå inte riktigt är korrekt.

När det gäller ÅMHM, vilket inte hör till ärendet, så är ÅMHM kanske en av de verksamheter som fortfarande håller på att finna sin form. Det stämmer att vi har påfört den myndigheten mycket uppgifter. Så kommer det kanske också att vara med polismyndigheten, det blir en tid av svängningar innan systemet stabiliseras, men det är ett bra förslag till att organisera myndigheten.

Från ltl Anders Erikssons och Ålands Framtids sida så måste man välja hur man vill ha det. Ska politiken i lagtinget och landskapsregeringen vara på en strategisk övergripande nivå som sätter tydliga mål, som någon annan sedan förverkligar och som man mäter, då måste man göra så här. Då kan inte ministrarna hålla i spaden ute i förvaltningen. Man kan inte få både och, det finns inte sådana supermänniskor som kan jobba 40 timmars dygn och 10 timmars vecka.

Talmannen

Replikskiftet är avslutat.

Ltl Åke Mattsson, replik

Tack, fru talman! Jag tänker ta upp språkparagrafen i styrelsens uppgifter. Jag var inledningsvis själv ganska negativ till den, jag tyckte att den var onödig och obehövlig. Men i debatten här så har det framkommit vissa saker, att paragrafen kan ha ett berättigande till den delen att det är klart att det är styrelsen som har ansvar och driver den här frågan.

Man kanske borde lyfta fram lite mera att det här är ett bra verktyg för polisledningen, polisen och andra. Man kan hänvisa till att det t.o.m. är inskrivet i lagen att vi ska jobba på svenska och att det mera är ett verktyg för polisen än att man mästrar polisen. För det är lite den vägen den här debatten har tagit. Jag har förstått att tanken inte var den när det diskuterades i landskapsregeringen, utan det var det omvända och därför så tycker jag att man kan ha paragrafen med.

Det håller det på att bli ett A-lag och ett B-lag inom polisen när det gäller språket.

Ltl Danne Sundman, replik

Fru talman! Det får ju inte bli ett A-lag och B-lag, att man är förmer för att man kan flera språk. Däremot är det heller inte en nackdel att kunna språk och det kan det aldrig vara. Men om det utnyttjas på det viset att myndigheten organiseras på ett sådant sätt att det sätter de som bara kan svenska i en sämre position, då blir det fel, tyvärr. Jag håller helt med ltl Åke Mattsson, egentligen är den här paragrafen onödig. Men mot bakgrund av hur det förhåller sig idag så blir den ett verktyg och ett försvar för polismyndighetens strävanden att göra allting rätt, vilket ju polisen verkligen vill, det är jag helt säker på. Vår poliskår vill ju göra rätt och man vill vara rätt positionerad i förhållande till självstyrelsen. Nu får man ett verktyg, ”titta här det står uttryckligen i lagen att det här ska redas upp”.

Som jag sade här tidigare så kommer det kosta och då måste vi vara beredda att ta emot den räkningen här, för det är utgifter som vi tidigare har knuffat framför oss.  

Ltl Åke Mattsson, replik

När det gäller A-lag och B-lag så har det också med utbildning att göra. I framtiden så kanske alla underbefäl som finns på Åland kommer att vara kunniga i finska, framförallt befälen. Det är frågan om det kommer flera svenskspråkiga utbildningar. Hur mycket ska man härifrån sanktionera att man går en helt finsk utbildning? Det kommer tydliga signaler från många poliser att det är svårt att få utbildning idag när man kommer lite högre upp.

Vår tidigare polismästare, Björn Andersson, har gjort ett väldigt bra arbete och lyckas få igenom att grundutbildningen arrangeras årligen och vi får grundutbildande poliser. Men är det bara manskapet som ska vara ålänningar och svenskspråkiga och resten måste kunna finska? För så ser det ut idag. Styrelsen bör dessutom verka för att det ska finnas svenskspråkiga utbildningar och fortbildningar. Det finns en viss farhåga, får styrelsen för mycket ansvar eller borde landskapsregeringen förhandla med den finska regeringen? Jag vet inte om just den där skrivningen är ändamålsenlig.

Ltl Danne Sundman, replik

Fru talman! Det där är väl ett bra exempel ur verkligheten. Ltl Åke Mattsson som har jobbat som polis vet hur det förhåller sig. Jag har hört samma sak av poliser, att det är svårt att vidareutbilda sig på svenska vidare upp i hierarkin inom polisen. Så ska det absolut inte få vara, men så är det och därför den här förtydligande bestämmelsen att det nu är styrelsens ansvar att fokusera på det här. Sedan är det säkert så att styrelsen får ta hjälp av både landskapsregering och landshövding och alla till buds stående resurser för att lösa det här.

Det här kan också kosta, fast det här borde inte få kosta. Det borde inte få kosta, då kan man till och med ta fram Ålandsöverenskommelsen och berätta att här har man förbundit sig. Då måste man kanske komma till en lösning där man diskuterar viss del av utbildning i samarbete med ett land åt ett annat väderstreck som har svenska som huvudspråk. Nå, det är en annan stor diskussion. Man får inte göra avkall på att man ska kunna bli polis, jobba som polis och utvecklas som polis på svenska.

Talmannen

Replikskiftena är avslutade.

Ltl Gunnar Jansson

Tack, fru talman! Jag blev polis första gången på sommaren 1966. Jag har erfarenhet av polischefskap i alla faståländska polisdistrikt, de var fem på den tiden. Jag har följt med polisens verksamhet under åren därefter med intresse.

Den här lagstiftningen är ett steg framåt. Förvaltningsrättsskyddet fungerar ju i huvudsak på två sätt; det preventiva som bygger på fungerande regler och en personal som kan och vill tillämpa reglerna, och sedan det repressiva, dvs. det som träder till om någonting går snett.

Min erfarenhet från då i tiden liksom nu i tiden är att vi har en hängiven poliskår. Jag är fullständigt övertygad om att poliskåren på Åland kommer att tillämpa de regler som vi här i lagtinget slår fast i demokratisk ordning.

De demokratiska rättigheterna alla poliser som medborgare har, att om reglerna inte är bra så följer man naturligtvis dem, hela vår rule of law principen vilar på det, men deltar i jobbet för att ändra på dem. Om reglerna inte är bra, så deltar alla, även poliser, i den demokratiska processen att ändra på regler som inte är bra.

Vi får nu en lagstiftning. Den är som den är. Den tjänar rättsäkerheten både för mottagare av förvaltningsservice från polisens sida men också personalen inom polisen som producerar den här servicen. Det är såsom det här systemet fungerar, i sista hand och ytterst att ge rättsskydd åt medborgarna.

Hjälpa och skydda heter det i USA, om ni känner till polisbrickorna i vårt system så har vi ju huvudsakligen att förhindra och beivra brott. Där har vi också preventionen som huvudregel. Polisen med sin blotta närvaro är ju till för att hjälpa medborgarna att följa de regler som vårt samhälle vilar på. Om det nu av olika orsaker misslyckas, vilket vi vet att det alltid nu och då gör, så inträder repressionen, dvs. man beivrar från polisens, de rättsvårdande myndigheternas och domstolarnas sida de överträdelser som kan ha förekommit.

På det hela taget så är jag också nöjd med lagförslagen. Behandlingen i utskotten har varit gedigen. Det här är ett sätt att komma vidare. Ingenting är färdigt och slutgiltigt. I denna lagstiftning ympar vi inför nästa lagstiftning och så vidare, och så vidare i denna eviga process som ju människoliv utgör, för att uttrycka sig så, och som samhällsbygget de facto är.

Sedan till det som vi från liberalernas sida har föreslagit som en ändring av 1c § i förslaget till ändring av landskapslagen om Ålands polismyndighet. Förslaget är utdelat och aviserat av utskottsordförande.

Vi har huvudsakligen tre skäl för detta ändringsförslag. Jag har använt de skälen tidigare, jag berörde dem i remissdebatten utan större framgång, men i politik ska man aldrig ge upp. Jag tänker igen återkomma till de skäl som styr mitt och liberalernas handlande i det här avseendet.

Det är fjärran från den skada som minister Lindholm här åberopade. Inte vill vi ju skada någon. Minister ställde frågan vilken skada det gör om man tar in en sådan här bestämmelse i 1 c § som säger, förutom annat, så ska också polisstyrelsen se till att alla delar av verksamheten fungerar på svenska. Vi undviker skadlig lagstiftning, det ska inte ett parlament överhuvudtaget syssla med. Men vi ska vara medvetna om effekterna av våra handlanden.

Jag läser nu utskottets förslag: ”Styrelsen ska biträda polismästaren i arbetet med att utveckla myndighetens verksamhet mot de mål som lagting och landskapsregeringen satt upp för verksamheten. Här har punkterna 1, 2, 3 undergått ändringar, dvs. de ändringar som framgår i betänkande och punkt 8; ”Styrelsen ska se till att alla delar av verksamheten fungerar på svenska”.

För det första, det här pekar ut polismyndigheten som någon som man måste hålla ett speciellt öga på. En myndighet som uppenbarligen inte förmår, av skäl som jag inte känner, följa den allmänna regeln som självstyrelsen bygger på och som de facto för första gången kom till uttryck i den nuvarande självstyrelselagen från 1991. Låt mig bara påminna om att vi hade självstyrelse i 80 år utan att det någonstans framgick att Åland är svenskspråkigt. År 1991 togs den regeln in och nu finns den där i paragraferna 36 och 38.

Vad är det hos polisen som kräver att de särskilt ska pekas ut som sådana som inte klarar av att följa lagen, i det här fallet självstyrelselagen? Jag känner inte till något sådant.

För det andra, lagstiftningens reflexiva effekt och den är allvarlig. Ibland talar man om e contrario tillämpning, men i det här fallet är den korrekta beteckningen reflexiv effekt. Det vill säga, i lagar där man tar in en positiv bestämmelse på detta sätt så gäller det i den lagen i fråga. Men hur är det i motsvarande lagar där den bestämmelsen saknas? Där kan man ju förledas att tro att där gäller icke samma krav på språktillämpning som självstyrelselagen anför. Det här har jag använt tidigare och jag är rätt så ensam om att uppenbarligen vilja tillämpa den här vägen. Jag menar att den är oerhört viktig att komma ihåg. När man har förvaltningslagstiftningen av det här slaget, och när man i en del lagar tar in en språkbestämmelse och i andra lagar låter bli, vad är då rätt tillämpning i de lagar där man låter bli? Ta t.ex. lagstiftningen om Ålands landskapsförvaltning eller stora enheter i våra förhållanden som ÅHS eller motorfordonsbyrån, överhuvudtaget i sammanhang där offentlig makt enligt självstyrelselagens 3 § utövas av landskapsregeringen eller av landskapsregeringen underlydande myndigheter. Det är angeläget att eftersträva en symmetrisk lagstiftning, enligt min mening. Visst kan man säga, som det har framförts i debatten, att i landskapslag kan man materialisera bestämmelser i självstyrelselagen. Visst, men det är normalt i sådana sammanhang där man inbjuds i landskapslagstiftning att göra det. Man brukar tala om lagförbehåll i grundlagarna. De här paragraferna 36 och 38 har inga lagförbehåll och behöver inga lagförbehåll för de är till lämpliga som sådana. Det är utmärkande för konstitutionsrätt i vårt land att där regler om detaljer saknas är grundlagen som sådan tillämplig. De som läser domstolsutslag märker ofta, ibland med viss häpnad, att man hänvisar direkt till paragrafer i grundlagen, självstyrelselagen och annan lagstiftning av grundlagsnatur när man inte har någon annan att tillämpa. Det är inte ovanligt, men det är inte regel i alla konstitutioner att deras artiklar är direkt till lämpliga.

Så till den tredje och kanske den allvarligaste invändningen. Nu inför vi då i polislagen en sådan här bestämmelse i enkel lagstiftningsordning, om inte liberalernas ändringsförslag godkänns. En majoritet av Ålands lagting inför en bestämmelse i polislagen som säger att verksamheten ska utövas på det här sättet som står i åttonde punkten. Okej, då kan ett kommande lagting, med en enkel majoritet, ta bort den föreskriften. Vilken rätt gäller då om vi här nu inte tror på självstyrelselagen? Jag skulle inte vilja vara med i det lagting som gör ett sådant tilltag. Det här är också en del av lagstiftningens reflektiva effekt.

Jag har onda aningar om hur det slutar. Det här sättet att stifta lagar i Ålands lagting är enligt min mening äventyrligt. Det borde underkastas en djupare bedömning och analys än bara att den inte är till skada eller att det är synd att fokus riktas på sådana här frågor. Det här är ju frågor av mycket djup självstyrelsepolitisk innebörd, att vi är medvetna om effekterna av vad vi gör.

Jag ska avsluta med en annan iakttagelse i samma ämne. Det har hänvisats till barnomsorgslagstiftningen och till annan lagstiftning. Den mest framträdande är naturligtvis undervisningslagstiftningen, som sådan, med de förbehåll som där finns.

Utmärkande för barnomsorgslagstiftning och undervisningslagstiftning är att där meddelar man undervisning, där kommunicerar man ut ett budskap. Nu talar vi om polisförvaltning. Polisförvaltning rör allt från fortkörning till en fråga om att rädda liv och upprätthållandet av de grundläggande värdena i hela samhällsordningen osv. Den här jämförelsen som ibland förs fram också här idag, att den här typen av, i många fall, deklaratoriska bestämmelser förekommer i viss lagstiftning och det skulle i sig vara motiv för att också förekomma i annan lagstiftning; ja, om det sker konsekvent. Men nu är vi långt ifrån konsekventa. Därför kommer jag att rösta för vårt eget ändringsförslag. Jag hoppas verkligen att ledamöterna gör detsamma eller åtminstone tänker över effekterna av att inte göra det. Tack, fru talman.

Minister Gun-Mari Lindholm, replik

Talman! Jag kan bara konstatera att åtminstone två lagar under lantrådet Viveka Erikssons ledning har tillkommit med särskild angivelse att svenska språket ska efterföljas, både barnomsorgslagen men också landskapsbidrag till bildningsförbund.

När det gäller språkutvecklingen i Finland så tycker jag att det är ganska intressant. Ltl Gunnar Jansson säger att han har en nästan femtioårig erfarenhet, kan han då se någon märkbar förändring vad beträffar språkutvecklingen i Finland som skulle ha betydelse för en myndighet, en verksamhet på Åland som ändå har så nära kontakt med motsvarande finsk myndighet?

Ltl Gunnar Jansson, replik

Tack, fru talman! Jag har två kommentarer till detta. De två första exemplen var just de utbildningslagar som jag hänvisade till, så där behöver jag inte fortsätta.

För det andra, ja, jag har erfarenhet och jag brukar sammanfatta det på det sättet att för 50 eller 80 år sedan, jag är inte så gammal ännu men snart nog, så fanns det få offentligt anställda människor i Finland som kunde många språk. Idag är det många offentligt anställda människor i Finland som kan färre språk och det är naturligtvis ett bekymmer.

Självstyrelselagen är en rikslag och den är tillämplig uttryckligen i Finland, naturligtvis på Åland där vi tillämpar den alla dagar. Men självstyrelselagen är minst lika tillämplig i Finland som på Åland. Därför är det en lag som ska tillämpas även i Finland.

Minister Gun-Mari Lindholm, replik

Talman! Jag tyckte inte riktigt att jag fick svar på min fråga. Jag kanske kan förtydliga min fråga. Språkutvecklingen i Finland, åtminstone som jag ser det, så har gått åt ett håll. Svenskan är undantryckt och finskan kommer allt mera. I de kontakter som de åländska myndigheterna på det svenskspråkiga självstyrda Åland ska ha med motsvarande myndigheter så ser jag att det finns en språksvårighet, det finns ett hinder och en gräns. Om inte vi håller på vår självstyrelselag och det svenska språket så kommer också Åland att behöva gå över till finska för att kunna ha den här myndighetskontakten. Har ltl Gunnar Jansson en annan åsikt? Ser man inte att det finns ett problem här, vad beträffar både myndighetskontakterna och utbildningen på svenska?

Ltl Gunnar Jansson, replik

Ja, det problemet har jag nu och kanske haft i 50 år, problemet tilltar, det håller jag med om. Jag hävdar att självstyrelselagen är ett mera verksamt instrument än landskapslag. Därför att självstyrelselagen är en rikslag, en av Finlands riksdag stiftad lag och gäller verksamheten i Finland. Den landslagslagstiftning vi stiftar här på Åland gäller i vår förvaltning. Vi kan mycket mera verksamt hävda krav på svenskspråkig service i Finland med stöd av självstyrelselagen än med en landskapslag.

Talmannen

Replikskiftet är avslutat.

Ltl Danne Sundman, replik

Fru talman! Om man får vara lite konspiratorisk så börjar man se ett mönster i liberalernas agerande. Först kastar man ut sitt flöte och sin krok i de här grumliga vattnen och sedan skickar man upp ltl Gunnar Jansson, tillika riksdagsrådet, för att hålla en lång akademisk utläggning om juridiken kring det här och det är svårt att bemöta åtminstone ifrån en motorcykelmekanikers sida. Men så mycket förstår en motorcykelmekaniker att en sådan här bestämmelse inte har någon reflexiv verkan på självstyrelselagens språkbestämmelse eftersom det inte står att verksamheten ska fungera på svenska. Det står att; ”styrelsen ska tillse att verksamheten till alla delar fungera på svenska”. Det är långt mycket mera än den ganska strikta definition av ämbetsspråket som finns i 36 § självstyrelselagen och skriftväxlingsspråket i 38 §. Det handlar om mycket mera. Utbildning och sådana saker regleras inte direkt i självstyrelselagen utan måste materialiseras i annan lagstiftning.

Som jag sade i mitt anförande så devalverar det här inte på något vis självstyrelselagens bestämmelser när det handlar om att ge styrelsen ett ansvar att se till att ett problem löses.

Talmannen

Tiden är ute!  

Ltl Gunnar Jansson, replik

Fru talman! Det är just i den andan vi lägger vårt ändringsförslag, så att basen för den åländska polisens verksamhet finns i självstyrelselagen för Åland avseende språk, service och all annan service, t.ex. rätten till god förvaltning som via självstyrelselagen kommer av grundlagen osv. Vi vill bredda perspektivet avsevärt mycket mera, det är vår grundläggande utgångspunkt.

Vad sedan gäller beskrivningen i lagförslagets 1 c § punkt 8 ”se till att alla delar av verksamheten fungerar på svenska” så trodde jag att det också var tänkt som det var skrivet. Men det är inte länge sedan som minister Lindholm sade att det här gäller bara myndighetskontakter, det gäller alltså inte de kontakter som jag har med polisen, om jag förstod henne rätt.

Ltl Danne Sundman, replik

Fru talman! Om man strikt ser vad som regleras i 36 § självstyrelselagen så har vi i lagtinget under min tid haft många olika diskussioner vad det omfattar och inte och var det behöver materialiseras. Det här är ett sådant fall där vi vet att det finns problem med kärnvärdena, med ämbetsspråket och med skriftväxlingsspråket. Det finns också andra mer perifera språkproblem som gör att man som ålänning inte kan utbilda sig som polis, som vi hörde här tidigare. I den här formuleringen omfattas alla de indirekta och direkta språkproblem som polismyndigheten har och som måste lösas. Nu sätter vi tydligt ansvar på polisstyrelsen att lösa det här tillsammans med myndigheten själva och med andra aktörer, såsom landskapsregeringen, lagting och statliga myndigheter som man samarbetar med. Det är tvärtom så att det här stärker självstyrelselagen och den regim som vi har och som i slutändan härrör från när självstyrelsen en gång kom till som ett substitut för återförening med Sverige.

Ltl Gunnar Jansson, replik

Tack, fru talman! Så där kan man resonera. I vårt sätt att resonera ingår inga konspirationer överhuvudtaget. Vi vill ha en god polisförvaltning som utgår ifrån självstyrelselagens 3 § och som följer alla de övriga föreskrifter i självstyrelselagen också vad gäller språkservice som däri ingår. Vi ser uppenbarligen olika på medel och mål.

Talmannen

Replikskiftet är avslutat.

Vtm Roger Jansson, replik

Tack, fru talman! Ltl Gunnar Jansson och jag delar uppfattningen att den symmetriska lagstiftningsprincipen ska hyllas. Vi har i självstyrelselagen 36 § angivet; ”landskapet är enspråkigt svenskt och att ämbetsspråket i stats-, landskaps- och kommunalförvaltning är svenska”. Där har sedan tolkats att vi i undervisningslagstiftningen behöver ha särskilda bestämmelser om undervisningsspråket för att tydliggöra den delen.

På högre nivå har vi nyligen gått in för att i lagtingsordningen 3 § stadga att lagtingets verksamhetsspråk är svenska. Under den föregående regeringen bestämdes i landskapslagen om landskapsbidrag till bildningsförbund att; ”villkor för erhållande av bidrag är att verksamhetsspråket är svenska. Vi bildningsarbete kan främmande språk användas”. Alltså symmetrin är sådan och bör därför kunna tillämpas också här i 1c § punkt 8.

Talmannen

Tiden är ute!  

Ltl Gunnar Jansson, replik

Fru talman! Det innebär säkert ingen behörighetsöverträdelse att förfara såsom föreslås i 1c § punkt 8, men det är en onödig bestämmelse. Det är så enkelt som jag ser det.

Hänvisning till bildningsförbundet, ja, men det är en undervisningsfråga, en utbildningslagstiftning och där har vi specialbestämmelserna i 40 § självstyrelselagen, det är riktigt.

3 § i lagtingsordningen, ja, jag var med och skrev den. De minnesgoda kommer kanske ihåg att uttryckligen på den grunden att lagtingsordningen är antagen i kvalificerad ordning så var det här möjligt, enligt min mening.

Vtm Roger Jansson, replik

Fru talman! Vi har noga studerat den är frågan om övrig lagstiftning. När det gäller landskapsbidrag till bildningsförbund så är det ju skilt stadgat om undervisningsspråket. Vid bildningsarbete kan främmande språk användas. Villkor för bidrag är dock att verksamhetsspråket ska vara svenska, det är på basen av det som står i 36 § självstyrelselagen. Rent materiellt så är det ju samma resonemang som man för i polislagen nu som vi gjorde i lagtingsordningen i den diskussionen, och som man också faktiskt gjorde under senaste period i barnomsorgslagen. Man skrev, kongruent med den här lagstiftningen om bildningsförbunden, att verksamhetsspråket är svenska inom barnomsorgen.

Talmannen

Tiden är ute!  

Ltl Gunnar Jansson, replik

Talman! Jag har ingenting att tillägga. Det är så här som vi brukar resonera. Det är tyvärr på det sättet och den här frågan är inte slutligt avgjord. Att frågan kommer upp på det här sättet i polislagstiftningen är ändå, enligt min mening, ett avsteg från tidigare princip där man säger att en myndighet ska tillse att en operativ verksamhet sker på ett visst sätt, i det här fallet till alla delar på svenska. Man har gjort ett avsteg från fördelningen mellan att styrelsen sköter administration och polismästaren operativitet. Här har man gett styrelsen att operativt uppdrag att vaka över sin egen myndighet uppenbarligen, om jag förstår punkten rätt och därför är den annorlunda än de exemplen som vicetalmannen hänvisade till.

Talmannen

Replikskiftet är avslutat.

Ltl Harry Jansson, replik

Tack, fru talman! Jag vill sälla mig till skaran ledamöter som strävar till att lugna ltl Gunnar Janssons oro för att lagtinget på något sätt skulle äventyra de språkliga arrangemangen i vårt örike. Självstyrelselagen lever sitt liv och har en särskild normhierarki som ledamoten mycket väl är medveten om.

Förhoppningsvis om majoriteten håller ställningarna här, så inför vi nu en kompletterande bestämmelser som de facto stärker den nya polisstyrelsens rätt att agera för svenska språkets bästa. Man kan bland annat se det ljuset av det som ltl Åke Mattsson tog fram, det faktum att utbildning på svenska inom polisen i Finland kommer att bli allt svårare. Då är det ju naturligt att nya polisstyrelsen i ljuset av den här nya bestämmelsen kommer att känna sig stärkt för att bl.a. äska om mera pengar för att kunna söka motsvarande utbildning på den svenska sidan.

Ltl Gunnar Jansson, replik

Tack, fru talman! Ja men, de här problemen är större än vad som står i en landskapslag, enligt min mening. Det är en skyldighet för republiken Finland att hålla med utbildning på de områden där inte vi själva gör det. Jag är gammal nog för att till och med ha medverkat vid en polisutbildning för manskap på Åland i början på 60-talet. Därför att det var stört omöjligt då redan att förmå Finland att producera polisutbildning på svenska. Till den delen har det blivit bättre, men det har ingenting med mina blygsamma insatser att göra.

Vi får, enligt min mening, inte handla så att Finlands ansvar för den här typen av offentlig verksamhet urholkas, i ett område där Finland uttryckligen är så nära med. Vi måste ställa krav på Finland att fullgöra sina förpliktelser.

Ltl Harry Jansson, replik

Vi är helt överens, ltl Gunnar Jansson, att det är så vi ska handla, men sedan är realiteterna någonting helt annat på vissa områden. Det får vi gemensamt fortsätta att arbeta för att förbättra. Vi kan konstatera att om man skulle koppla ihop det här till diskussionen om avräkningsgrundens storlek så borde ju de facto språkaspekterna vägas in som en motiverande höjningsfaktor med tanke på de merutgifter vi har att vänta i framtiden, men det är en annan diskussion.

Jag hoppas att även kommande lagting kommer att anse att det är viktigt att i vissa lagtexter inta tydliga bestämmelser som säger att verksamheten ska bedrivas på svenska. Det äventyrar på inget sätt det faktum att självstyrelselagen mycket tydligt reglerar ämbetsspråket.

Ltl Gunnar Jansson, replik

Tack, fru talman! Kollegan Harry Jansson skissar här på en intressant framtid. Om så sker, och då är jag säkert inte längre med här åtminstone, så blir det alldeles särskilt viktigt att hålla ordning på det som jag nämnde som min tredje punkt. Det vill säga om man då inför krav på språkbehandling i Ålands i lagting i landskapslagar med enkel ordning så ska man vara medveten om att den bestämmelsen också kan tas bort i enkel ordning. Då skulle man alltså göra språkskyddet på Åland beroende av en enkel majoritet i Ålands lagting och det vill jag avråda ifrån, om jag förstod inlägget rätt här.

Talmannen

Replikskiftet är avslutat.

Ltl Åke Mattsson, replik

Tack, fru talman! Inledningsvis kan jag konstatera att jag håller med ltl Gunnar Jansson till många delar. Jag var själv mycket skeptisk till den här formuleringen. Jag kommer ändå inte att stöda reservationen. Jag anser att det finns godtagbara förhållanden för att bestämmelsen ska vara kvar här.

Jag tycker att man inte ska undergräva självstyrelselagen genom att skriva in den i övriga paragrafer. Här står det att styrelsen har ansvar för det här. Det är styrelsen som ska se till att det fungerar på svenska. Det står ingenting att språket är svenska, utan att man ska se till att det fungerar. Det gäller bl.a. register och dataprogram. Vapenregistret har länge varit på finska men nu har det kommit på svenska. Till den delen måste jag säga att det fungerar väldigt bra med riket just nu, alla nya register kommer på svenska, så där går det framåt.

Det kan ju vara andra omständigheter där styrelsen verkligen får ta ett krafttag och vara ett stöd för polisen, framförallt när det gäller utbildningen.

Ltl Gunnar Jansson, replik

Kollegan Mattsson och jag är väl de som har praktisk poliserfarenhet här i dagens lagting. Jag uppskattar ltl Mattsons synpunkter. Vi har många goda diskussioner om de här frågorna.

Om ansvaret för språkvården inom polisen läggs på polisens styrelse så får den ändå inte tas bort från manskapet, inte från de som gör jobbet. Jag är säker på att ingen polis kommer att reagera på det sättet. Men när man diskuterar i termer av ansvar så här får styrelsen ett ansvar att tillse att en operativ verksamhet sker på ett visst sätt. Vi måste vara mycket noggranna med att det på inget sätt tar bort ansvaret för den enskilde polismannen eller kvinnan att följa självstyrelselagen.

Ltl Åke Mattsson, replik

Den biten kan jag hålla med om fullständigt. Jag tror att det inte är ett så stort problem. Man ska ha en mental störning om man som polis flyttar till Åland för att pratar finska. Sedan kan det man pratar ”närpesiska” sinsemellan, vilket egentligen är svenska men som ingen annan förstår heller.

Det viktiga är att polisen känner att de har ett stöd, att man kan vända sig till de trojanska hästarna som finnarna har satt in här som försöker förfinska den åländska polisen. Man har en möjlighet att styrelsen ska överväga det.

Det största problemet är inledning på punkt 8; ”se till att alla delar” man borde ha använt en annan formulering än att ”se till” då tror att vi hade sluppit den här olyckliga debatten kring den här paragrafen.

Ltl Gunnar Jansson, replik

Tack, fru talman! Igen är vi på samma linje helt och hållet. ”Se till” ger ju ett operativt uppdrag, när vi alla tillsammans här har stått och förkunnat att styrelsen inte är operativ. Styrelsen är administrativ, det är alldeles riktigt. Jag reagerade precis på samma sätt. I det förslag som vi har så stryker vi punkt 8, där det här uppdraget försvinner och i stället tar in föreskrifter som säger; ”verksamheten utförs enligt föreskrifterna i självstyrelagen och utvecklas mot det mål som lagtinget och landskapregeringen ställt upp”.

Talmannen

Replikskiftet är avslutat.

Ltl Barbro Sundback, replik

Tack, fru talman! Jag tycker att den här diskussionen ur liberalernas synvinkel bara blir trassligare och trassligare. Redan i den första barnomsorgslagen kom liberalerna med förslaget att verksamhetsspråket skulle vara svenska. Det fördes in då, och det kunde vi vara eniga om.

Det finns t.o.m. i lagtingsordningen som är en lag, där ltl Gunnar Jansson själv var med. Den här diskussionen känns inte längre övertygande. Vi har ju fört in detta med verksamhetsspråket i många lagar och ingen här uppfattar att vi har satt självstyrelselagen ur spel.

Vem ska övervaka verksamhetsspråket inom barnomsorgen? Ska socialnämnden ha någon uppgift?

Ltl Gunnar Jansson, replik

Tack, fru talman! Jag ville inte gå in på den frågan tidigare men gör det nu därför att kollegan Barbro Sundbacks påpekande är mycket riktigt. Barnomsorgen är en kommunal angelägenhet. Kommunerna i riket har inga språkföreskrifter överhuvudtaget, de väljer sitt eget språk. Verksamheterna i kommunerna på Åland styrs av självstyrelselagen, så där har vi en betydande skillnad. Men nu kom vi långt bortifrån polisväsendet, men påpekandet var väsentligt.

Ltl Barbro Sundback, replik

Vad jag har förstått så är det nu då, enligt ltl Gunnar Jansson, så tokigt att det är styrelsen som ska se till att verksamhetsspråket inom polisen är svenska. Det gäller den här övervakningen. Men nog måste det väl vara socialnämnder i kommunerna som ska övervaka i kommunerna att verksamhetsspråket inom barnomsorgen är svenska? Analogt med det. Det här är nog mera advokatyr än att det har någonting med verkligheten att göra. Den bestämmelsen i barnomsorgslagen har inte varit problematisk och den här bestämmelsen kommer antagligen inte heller att bli problematisk. Det finns tydligen ett politiskt motiv att ta in det här i polislagen, och det fanns det i barnomsorgslagen och det fanns det i lagtingsordningen. Det är väl ändå att verkligen ifrågasätta självstyrelselagen och det gjorde jag när vi diskuterade det här men det var ett politiskt ställningstagande.

Ltl Gunnar Jansson, replik

Bestämmelsen finns av skäl som jag nämnde i lagtingsordningens första kapitel bland de deklaratoriska bestämmelserna.

Men grundfrågan där, ja, om det är obehagligt att jag uttrycker mig juridiskt så borde jag inte göra det. Men jag kunde göra det på basen av kollegan Sundbacks väsentliga fråga; vem övervakar att barndagvården i kommunen utförs på svenska? Troligen landskapsregeringen via landskapsandelssystemet. Jag känner inte så här spontant till några andra mekanismer enligt vilka det skulle fungera. I så fall måste jag hänge mig åt advokatyr för att komma med en tydligare beskrivning och det kanske vi inte ska göra.

Talmannen

Replikskiftena är avslutade.

Vtm Viveka Eriksson

Talman! Det här kommer lite på sidan om ärendet, men när ltl Sundback stiger upp och påstår att liberalerna har förts fram att verksamhetsspråket ska vara svenska i barnomsorgslagen, så det stämmer ju inte. Tvärtom, jag kommer ihåg att socialdemokraterna och liberalerna gemensamt talade mot det här. Jag skulle nästan tippa att vi till och med hade en gemensam reservation mot det förslaget. För liberalerna har haft en linje hela vägen, ända sedan 90-talet när barnomsorgslagen behandlades och all annan underlydande landskapslagstiftning, att självstyrelselagen säger att förvaltningsspråket är svenska, skriftspråket är svenska. Vi har också systematiskt och väldigt starkt drivit den frågan i alla sammanhang.

När vi satte i regeringen var vi väldigt noga med att gång efter annan påtala det här eftersom vi anser att det är landskapsregeringens sak att påtala det gentemot riksmyndigheterna. Det här är en mycket, mycket viktig fråga för liberalerna. Därför blir jag nästan upprörd när liberalernas motiv börjar ifrågasättas för varför vi håller fast vid vår linje, som vi har hållit hela tiden.

Det här framfördes i samband med polislagens remiss. Jag har för mig att ltl Gunnar Jansson pekade på den här punkten och det framfördes under utskottsbehandlingen. Det har varit vår linje. Det är inte några skriverier i tidningen eller mässaspalter som har ändrat på vår linje. Det ska vara alldeles klart och tydligt.

Jag ber om ursäkt för att jag kom lite på sidan, men jag tycker att sådana här påståenden måste tillrättaläggas.

Ltl Barbro Sundback, replik

Ja, jag kommer också ihåg och att liberaler och socialdemokrater drev en gemensam linje i barnomsorgslagen. Mitt minne säger mig att kompromissen blev den som en liberal förde fram. Jag tycker inte att det är någonting att skämmas över. Jag tyckte att det var en ganska bra lösning av det hela och det har ju blivit bestående. Det finns ju i många andra lagstiftningar efter det.

Sedan kan jag ha full respekt för att liberalerna fortsätter att driva det här. Men förra perioden då? Hur var det med lagen om folkbildningsarbetet och förra barnomsorgslagen som kom förra perioden? Jag tänker bara på linjen, som var så viktig.

Vtm Viveka Eriksson, replik

Talman! Det som är intressant i sammanhanget är att socialdemokraterna inte följer någon linje, för det är lite olika beroende på.

Ltl Barbro Sundback, replik

Nej, jag tycker att det faktiskt inte är av så stor betydelse, inte socialdemokraterna heller. Om det finns en majoritet som vill förtydliga lagstiftningen på den här punkten så ser jag det inte som något avsteg från självstyrelselagen. Det har gjorts i många sammanhang, till och med i lagtingsordningen.

Vtm Viveka Eriksson, replik

Talman! Det har inte gjorts på ett sådant sätt att man ålägger en underlydande myndighets styrelse att övervaka. Nog är det ju landskapsregeringens sak att övervaka att man lever upp till självstyrelsens stadganden. Det som ni nu skriver in i polislagen, det är att styrelsen ska se till det här, och det är att lägga det på för låg nivå.

Talmannen

Replikskiftena är avslutade. Begärs ordet? Diskussionen är avslutad.

Detaljbehandlingen börjar. I detaljbehandlingen föreläggs det andra lagförslaget paragraf för paragraf medan de övriga lagförslagen föreläggs var för sig i deras helhet.

Föreläggs först förslaget till polislag för Åland för godkännande i dess helhet. Lagförslaget är godkänt.

Föreläggs först förslaget till landskapslag om ändring av landskapslagen om Ålands polismyndighet för godkännande paragraf för paragraf.

Föreläggs

1 § Godkänd

1a § Godkänd.

1b § Godkänd.

1c § Begärs ordet?

Ltl Katrin Sjögren

Talman! Jag föreslår att 1c § ändras enligt aviserat ändringsförslag.

Ltl Mats Perämaa

Fru talman! Jag ber att få understöda ltl Sjögrens förslag.

Talmannen

Under diskussionen har ltl Katrin Sjögren, understödd av ltl Mats Perämaa, föreslagit att 1c § godkänns i den lydelse den har i det förslag som ltl Katrin Sjögren har delat ut.

Är redogörelsen riktig? Redogörelsen är riktig.

Omröstning kommer därför att verkställas.

Den som omfattar lag- och kulturutskottets betänkande, röstar ja; den som omfattar ltl Katrin Sjögrens ändringsförslag, röstar nej.

Kan omröstningspropositionen godkännas? Godkänd.

Jag ber ja-röstarna resa sig. Jag ber nej-röstarna resa sig. Talmannen röstar ja.

Majoritet för ja. Lagtinget har alltså godkänt lagtexten enligt utskottets betänkande.

Föreläggs 2 § Godkänd.

4 § Godkänd.

5a § Godkänd.

5b § Godkänd.

5c § Godkänd.

5d § Godkänd.

5e § Godkänd.

5f § Godkänd.

5g § Godkänd.

11 § Godkänd.

Föreläggs lagens ingress. Godkänd.

Föreläggs ikraftträdelsebestämmelsen. Godkänd.

Föreläggs förslaget till landskapslag om ändring av räddningslagen för landskapet Åland för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslag om ändring av 1 och 10 §§ landskapslagen om behandling av berusade för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslag om ändring av landskapslagen om ordningsvakter för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslag om ändring av 3 § förvaltningslagen för landskapet Åland för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslag om  ändring av 1 § landskapslagen om tillämpning i landskapet Åland av riksförfattningar om personuppgifter för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslag om ändring av 9 § landskapslagen om allmänna handlingars offentlighet för godkännande. Lagförslaget är godkänt.

Lagförslagens första behandling är avslutad. Ärendets första behandling är avslutad.

Första behandling

6        Plantmaterial och skydd för växters sundhet

Social- och miljöutskottets betänkande (SMU 3/2012-2013)

Landskapsregeringens lagförslag (LF 7/2012-2013)

Först tillåts diskussion och efter det börjar detaljbehandlingen av de lagförslag som ingår i betänkandet.

Diskussion.

Ltl Christian Beijar

Fru talman! Social- och miljöutskottet föreslår att lagtinget godkänner landskapsregeringen lagförslag om plantmaterial och skydd för växters sundhet.

Utskottet föreslår att lagförslagen antas med några få ändringar.

Fru talman! Jag har en liten justering som behöver antecknas behöver antecknas. Det gäller detaljmotiveringen när det gäller andra lagen så står det landskapslag om skydd för växters sundhet. Det har fallit bort lite ord där. Det ska stå; landskapslag om tillämpning på Åland av lagen om skydd för växters sundhet. Jag ber att få detta justerat.

I gällande lagstiftning har lagen om plantmaterial och lagen om skydd för växters sundhet gjorts tillämpliga i landskapet genom en och samma blankettlag. Landskapsregeringen föreslår nu att de båda rikslagarna görs tillämpliga genom två skilda blankettlagar.

När det gäller lagstiftningens innehåll konstaterar utskottet att de båda lagarna utgör en viktig grund för en sund odling på Åland med friska växter utan sjukdomar, vilket är en avgörande produktionsförutsättning för de verksamma inom näringen. Regelverkena är tekniska vilket gör att det i det här fallet är ändamålsenligt att använda sig av blankettlagar och blankettförordningar. Utskottet har erfarit att landskapsregeringen kontinuerligt följer med förändringar i lagstiftningen så att nödvändiga avvikelser kan införas i den åländska lagstiftningen.

Lagen om plantmaterial omfattar endast saluföring, produktion eller import av plantmaterial som idkas yrkesmässigt. Hobbyodlare och näringsidkare som i obetydlig omfattning importerar eller producerar plantmaterial omfattas inte av ifrågavarande lagstiftning. Landskapsregeringen bör enligt utskottet vara uppmärksam på detta och tillse att allmänheten informeras om gällande bestämmelser om import av plantmaterial och om risker vid införsel av okontrollerade plantor.

Lagstiftningen är angelägen då trädgårdsodlingen har stor kommersiell betydelse för Åland. Odlarna följer noggrant med utvecklingen inom näringen utanför Åland och prövar gärna nytt plantmaterial och nya produktionsformer. Utskottet har uppfattat att yrkesodlarna är mycket måna om att endast importera bra plantmaterial. Det har också framkommit att landskapsregeringen och odlarna är ense om att samarbetet nuförtiden löper bra och tillsynen sköts effektivt och smidigt utan onödig byråkrati.

Utskottet vill framhålla att det är nödvändigt att tillämpningen av lagstiftningen även i fortsättningen sköts smidig och anpassas till förhållandena i landskapet. Jämfört med övriga Europa är odlingen på Åland småskalig och därför bör de lösningar som väljs stå i proportion till dessa förhållanden. Landskapsregeringen har ett långtgående samarbete med rikets myndigheter vilket gör att landskapsregeringen har tillgång till den kompetens som är viktig för att uppnå en säker organisation för tillsynen. 

I riket har det föreslagits att ersättningen för att bekämpa skadegörare enligt lagen om skydd för växters sundhet bör minskas. I utskottet har vi erfarit att landskapsregeringen kommer att granska förslaget och eventuellt anpassa lagstiftningen för de åländska förhållandena. I allmänhet krävs relativt kraftiga och omfattande åtgärder för att begränsa spridning av skadegörare. Det är därför berättigat att hålla en god ersättningsnivå som står i proportion till de åtgärder som åläggs odlarna.

Med hänvisning till att nya statsstödsregler väntas så småningom och då nya bestämmelser om ersättning för bekämpning kommer att föreslås i riket har utskottet erfarit att landskapsregeringen avvaktar tillsvidare med att föreslå ändringar i stödreglerna. Tack, fru talman.

Ltl Axel Jonsson, replik

Tack för redogörelsen. Jag har en konkret fråga. Varför har man i utskottet gått in för att göra det som tidigare var en blankettlag till två olika blankettlagar? Finns det något bakomliggande resonemang kring det?

Ltl Christian Beijar, replik

Fru talman! Vi har velat sära på dem och följa landskapsregeringens förslag. Det är den förklaringen.

Talmannen

Replikskiftet är avslutat.

Ltl Torsten Sundblom, replik

Tack, fru talman! Utskottsordförande redogjorde för att det här gäller yrkesmässigt saluförd produktion och import. Det är väldigt viktigt att den saken kommer upp, för största hotet är egentligen privatpersoner som tar sitt äppelträd till sin sommarstugetomt och planterar det. Det är det största hotet för att det ska komma in oönskade sjukdomar. Jag ville ta en replik för att vi ska uppmärksamma det extra.

Ltl Christian Beijar, replik

Tack för det ltl Torsten Sundblom, som också är medlem av social- och miljöutskottet. Det är helt korrekt det som ledamoten är inne på. Den privata importen är en väldigt viktig fråga. Man måste hålla ögonen på den privata importen. Det är framförallt viktigt att landskapsregeringen informerar om det här ordentligt så att inte den komplikationen uppstår att någon importerar fruktträd som är smittade.

Talmannen

Replikskiftena är avslutade.

Ltl Anders Eriksson

Fru talman! Det var en bra men kanske rätt teknisk presentation som ordförande Beijar gav av det här betänkandet. Därför vill jag gärna understryka ett par saker.

Om man inte har satt sig in i det här så kan man tycka att det kanske är en icke fråga, men enligt mitt förmenande så är det en ganska viktig lagstiftning.

Trädgårdsodlingen har en väldigt stor betydelse när det gäller lantbruksklustret här på Åland. Odlarna är, precis som det står i betänkandet, progressiva och nytänkande. Det sker mycket utveckling inom det här området och det har en stor ekonomisk betydelse, inte bara för odlarna utan för hela det åländska samhället.

Jag vill understryka det här som ordförande Beijer läste upp, det sägs att den här lagen bara tar upp kommersiell odling. Men det framkom inte riktigt varför det är ett bekymmer. Jag vill understryka varför vi tycker att landskapsregeringen ska vara uppmärksamma på det här. Ja, det är just det som ltl Sundblom i sin replik ville understryka också. Det kan vara någon hobbyodlare på sin tomt hemma, t.ex. mitt i Västanträsk, som importerar 2-3 äppelträd och det kan det få förödande konsekvenser om de innehåller sjukdom.

Den yrkesmässiga importen är väldigt, väldigt noga kontrollerad med växtpass osv. Men när det gäller den privata importen så finns det egentligen ingen kontroll överhuvudtaget. Vi vill att landskapsregeringen ska vara väldigt uppmärksam på det annars kan det få ganska stora konsekvenser.

Som det sägs i det här betänkandet så i riket är man på gång att göra ändringar när det gäller ersättningen för de som bekämpar skadegörare. Det kan leda till otroligt stora kostnader om man t.ex. i Västanträsk skulle råka få in päronpest eller någonting i 2-3 äppelträd och man blir tvungen att hugga ner flera hektar runtomkring. Det kan få förödande konferenser.

Därför tycker jag att det är bra att det i utskottsbetänkande sägs; ”det är berättigat att hålla en god ersättningsnivå som står i proportion till de åtgärder som åläggs odlarna”. I Finland har trädgårdsodling inte alls samma betydelse som här på Åland. Mot den bakgrunden vill jag understryka de här sakerna som en komplettering till en för övrigt bra presentation.

Talmannen

Begärs ordet? Diskussionen avslutad.

Detaljbehandlingen börjar. I detaljbehandlingen föreläggs lagförslagen var för sig i deras helhet.

Föreläggs först förslaget till landskapslag om tillämpning på Åland av lagen om plantmaterial 5 för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslag om tillämpning på Åland av lagen om plantmaterial 5 för godkännande. Lagförslaget är godkänt.

Föreläggs förslaget till landskapslagen om ändring av ändring av 3 och 6 §§ landskapslagen om tillämpning i landskapet Åland av lagen om växtskyddsmedel för godkännande. Lagförslaget är godkänt.

Lagförslagens första behandling är avslutad. Ärendets första behandling är avslutad.

Enda behandling

7        Självstyrelsens kärnområden

Landskapsregeringens svar (S 2/2012-2013-s)

Ltl Axel Jonssons m.fl. spörsmål (S 2/2012-2013)

Först tillåts diskussion. Under diskussionen i ärendet kan det väckas förslag om en åtgärdsuppmaning till landskapsregeringen. Förslaget ska samtidigt skriftligen överlämnas till talmannen.

Om det har väckts förslag om en åtgärdsuppmaning bordläggs ärendet efter avslutad diskussion till en avgörande behandling vid ett plenum tidigast följande dag. Om inget förslag till åtgärdsuppmaning väckts antecknas landskapsregeringens svar för kännedom.

Under diskussionen kan ärendet bordläggas första gången på begäran av två ledamöter och efter det en gång om lagtinget så beslutar.

Diskussion. Lagtingsledamoten Axel Jonsson får först läsa upp klämmen.

Ltl Axel Jonsson

Tack, fru talman! Det här är viktiga frågor för självstyrelsen. Med anledning av att inte hänt så mycket på den senaste tiden så ställer vi med stöd av 37 § lagtingsordningen följande spörsmål: När och med vilka åtgärder ämnar landskapsregeringen tillse att målsättningarna i den parlamentariska kommitténs betänkande från 2009 förverkligas?

Minister Gun-Mari Lindholm

Talman! Jag är glad för att den här frågan ställs och att det finns ett intresse för självstyrelsens kärnområden. Av förekommen anledning, när vi hade upp den enskilda frågan häromsistens, så blev jag lite fundersam över vart man är på väg och vilken framtid man vill ha för de här frågorna.

Det finns den parlamentariska kommitténs betänkande från 2009. Under den förra mandatperioden så fanns det olika dokument som man kanske hade som avsikt att föra vidare, många av de här områdena har problematiserats, men tyvärr har de inte kommit vidare i konkretiseringar, särskilt när det gäller hembygdsrätten.

Jag har åtminstone upplevt att man i lagtinget har varit ense om att man ska försöka lagstifta så mycket som möjligt när det gäller de enskildas rätt vad beträffar hembygdsrätten och att man i synnerhet ska hitta en lösning för studerande utanför Åland som efter fem års studier tappar sin hembygdsrätt. Det är klart att man får hembygdsrätten tillbaka väldigt snabbt när man flyttar tillbaka. Det har också funnits ett önskemål om att man ska hålla kvar de studerande, så att man inte klipper av navelsträngen till Åland. 

När vi skrev regeringsprogrammet så sade vi att frågor rörande hembygdsrätten, jordförvärvsrätten och näringsrätten ska följa tydliga och klara normer för att skapa ett rättssäkert och jämlikt förfarande. Dessa normer ska utgå ifrån lag. Sedan lagarna tillkom i den tappningen de är idag så har ingen förändring gjorts. Vi kan konstatera att det är väldig svår lagstiftning eftersom man inte har gjort förändringar. Försök har gjorts men man har inte lyckats.

De här områdena är inte föremål för att man ska göra så väldigt många förändringar i dem eftersom de är kärnområden. Går man in och gör förändringar så ska det också var långsiktiga hållbara förändringar.

Landskapslagen om åländsk hembygdsrätt är från 1993. Landskapslagen om jordförvärvsrätt är från 2003 och där har inte några ändringar gjorts överhuvudtaget. En liten förändring har gjorts i lagen om näringsrätt från 1999. Man har verkat under en ganska lång tid under lagarna utan att göra förändringar.

Den parlamentariska kommittén har ringat in olika områden där man har varit ense. Det ligger som ett bra underlag när man ska fortsätta arbetet med att reformera.

Vi inledde arbetet med att gå igenom personer som kanske hade trott att de hade hembygdsrätt, men där det tyvärr visade sig att man inte hade det. Det här arbetet gjorde i fjol somras av högskolepraktikant. Vi kunde konstatera att den sommaren fick vi 297 nya ålänningar. Vid ett svar på en fråga som ställdes här i lagtinget ett år tidigare så var svaret 2 stycken. Vi kunde konstatera att det var 295 flera än vad svaret var då.

Det är viktigt att man går igenom de här frågorna och frågeställningarna väldigt noggrant.                

Det här är då en inledning på det arbetet. Vi har valt att inleda med hembygdsrättsfrågorna. Hembygdsrätten ligger ändå som en grund, både för jordförvärvsrätten och för näringsrätten, därför är det viktigt att man reglerar hembygdsrätten.

Avsikten, när man fick den nya hembygdsrättslagstiftningen 1993, var att det skulle följa en förordning. Den förordningen har heller inte blivit skriven. Det finns absolut ett behov att arbeta med de här frågorna.

I oktober 2012, senaste oktober, så tillsatte landskapsregeringen en arbetsgrupp som ska revidera lagstiftningen om hembygdsrätt, jordförvärvsrätt och näringsrätt. Landskapsregeringen, ministrarna och lantrådet, har haft en genomgång av samtliga lagstiftningar och i enlighet med den parlamentariska gruppens dokumentation har vi tagit ut frågor som vi anser att det finns behov att göra förändringar i.

Nu har gruppen först tagit sig an hembygdsrättsfrågorna. Vi nämner det på sidan 2 i vårt svar att man ska lagstifta om hembygdsrättsregistret. Man måste lagstifta om att det ska få finnas ett hembygdsrättsregister.

Den egentliga bo och hemvisten är idag en ganska svår frågeställning. Man bor på väldigt många olika ställen. Man kan vara bosatt i ett hus i södern 6 månader i året, man kan bo i skärgården 3 månader och man kan bo i en lägenhet i Saltvik 3 månader eller resten av året. Var är den egentliga bo och hemvisten när man ska börja diskutera det? Det där är en frågeställning som man måste försöka hitta en lösning på.

När det gäller kunskaper i svenska språket så i enlighet med erhållandet av finskt medborgarskap så finns det en reglering och det finns dokumenterat i en förordning hur det här ska gå till. Vi saknar den förordningen på Åland om förfaringssättet. Idag har man förlitat sig på att man har träffat de här personerna, man har talat med dem och då blir det ofta en subjektiv bedömning ifrån olika tjänstemän på rättsserviceenheten. För att uppnå en rättssäkerhet så måste anhållan om det andra medborgarskapet ha ett likadant förfarande.

Sedan en väldigt, väldigt viktig fråga i det här sammanhanget också när det gäller hembygdsrätten. Det gäller frågan om de studerande; hur länge, på vilket sätt? Vi har nu ett framtaget förslag. Det är inte i enlighet med det förslaget som jag själv hade som min första prioritet, att man skulle knyta det till studieförmånerna och studiestödsregistret. Man har ett annat förfaringssätt som går ut på att man behåller hembygdsrätten under de fem år som man studerar och sedan får man ett besked hem om att tiden håller på att rinna ut. Man ska sedan själv bevisa att man har varit studerande och då kan man ha återkopplingen till studieförmånsregistret. Det åligger på den enskilda individen att visa på att man har varit studerande.

Till den delen har det här arbetet nu framskridit. Vi har för avsikt att komma med den här delen av lagstiftningen till lagtinget under hösten. Jag hade hoppats på att vi skulle kunna komma med en lagstiftning i september, men det är andra lagstiftningar som har dragit ut på tiden och då kommer vi istället att komma med den här lagstiftningen ett par månader senare än vad min ambition var.

Under den här mandatperioden så avser vi att komma till lagtinget för avgörande med de andra lagstiftningspaketen.

Värdefullt att nämna i det här sammanhanget är byggnadslagen och samhällsplaneringen. Det arbetet pågår i arbetsgruppen för infrastruktur, som är under samhällsservicestrukturreformen, vi får se vilket resultat som kommer därifrån. Jag ser att det finns ett behov av en samordning av samhällsplaneringen också för att råda bot på jordförvärvsfrågor vilket är väldigt, väldigt viktigt i det här sammanhanget. Det är viktigt att man får en enhetlighet när det gäller planerade områden.

Så långt har vi kommit i det här arbetet. Jag tycker att det var en liten lustig frågeställning i spörsmålet; att tre år har gått. Dåvarande opposition med mig själv kanske i spetsen, jag kanske inte var första undertecknare men jag var en ivrig påhejare, ville utveckla självstyrelsen. Av dessa tre år har vi suttit ett och ett halvt år och så här långt har vi nu kommit. Vi kan inte ansvara för den andra tiden av ett och ett halvt år, men åtminstone för den tiden vi har suttit. Därför tycker jag att det är bra att vi har det här spörsmålet så att man också vet hur pass långt arbetet har framskridit, vad avsikten med arbetet är och i vilken riktning arbetet går. Det är bra att få den här inputen till det fortsatta arbetet. Tack.

Vtm Viveka Eriksson, replik

Talman! Jag vill påstå att svansföringen från ministerns sida är lite lägre än vad den var i den spörsmålsdiskussionen, men det ska vi återkomma till.

Jag noterade att ministern framhöll att betänkandet ligger till grund för det fortsatta arbetet och det tycker jag att är bra. Jag uppfattade det också som att ministern tycker att det var bra att det togs fram ett betänkande där vi samlat lade grunden för hur vi ska jobba vidare med de här synnerligen svåra frågorna.

I det betänkandet så pekade man på behov av lagstiftningsåtgärder när det gäller hembygdsrätt, jordförvärvsrätt och näringsrätt. Men det enda som ministern egentligen pratade om var hembygdsrätten och de studerandes möjlighet till en förlängd tid.

Minister Gun-Mari Lindholm, replik

Jag kommer inte ihåg vilken svansföring jag hade då, åtminstone känner jag ett väldigt stort ansvar för de här frågorna i den här regeringen. Jag vill nog lova, om det är någon slags svansföring eller inte, att jag jobbar väldigt intensivt med de här frågorna.

När det gäller att man utgår ifrån den parlamentariska kommitténs betänkande, så har jag varit lite fundersam över om alla partier fortfarande står bakom det. Det är jättebra att också få veta att man står bakom det, så att vi vet riktningen, för det är väldigt väl upp stolpat vilka områden som man har varit ense om. Det är bra att man uttalar detta.

Vtm Viveka Eriksson, replik

Talman! Jag noterade nogsamt att ministern sade att de har tagit ut frågor som de anser att det finns behov av att gå vidare med. Men faktum är att det finns en samlad åsikt från alla partier att lagstiftning bör fås inom alla tre områden, just för att skydda lika behandlingsprincipen, så att man ska komma ifrån tillämpningsdirektiv och olika riktlinjer som har lett till att kravet på lika behandling inte har uppfyllts. Därför har alla sagt att det behövs lagstiftning.

På sensommaren, när vi lämnade regeringen, då hade vi ett underlag för just den här lagstiftningsåtgärden, ett ganska omfattande lagstiftnings-PM som hade utarbetats på tjänstemannanivå. Varför tar inte ministern det och bearbetar det politiskt och faktiskt kommer vidare? Nu har det snart gått två år och ingenting har hänt.

Minister Gun-Mari Lindholm, replik

Det har blivit ett mantra att ingenting har hänt. Det finns nu ett svar på det här spörsmålet där vi säger hur vi har inlett det här arbetet och vilka av punkterna som är viktiga att lyfta. De är långtgående utifrån betänkandet från den parlamentariska kommittén men det är också lite utövar det.

Vi inleder arbetet med hembygdsrätten, vi fortsätter med de andra områdena. Just nu för tillfället, när frågan ställs, så har vi satt krutet allra mest på hembygdsrätten därför att den är också grunden för de andra rätterna.

Talmannen

Replikskiftet är avslutat.

Ltl Katrin Sjögren, replik

Talman! Landskapsregeringen och ministern reviderar tidsplanen. Här på sensommaren fick vi höra att det snabbt skulle låta sig göras att revidera hembygdsrättslagen. Även under den förra mandatperioden skulle det här ordna sig som på ett litet kick. Vi kan konstatera att när man sätter sig in i de här frågorna så är de mer komplicerade än man kan tro.

En konkret fråga: Landskapsregeringen skriver att man tänker titta på villkor gällande tillfredsställande kunskaper i svenska språket och vad som avses med tillfredsställande kunskaper. Hur diskuterar man t.ex. när det gäller anhöriga? Om man flyttar till Åland och så har man en äldre mamma, som man vill ta med till Åland, och som kanske pratar spanska eller litauiska. Har man funderat kring just den biten?

Minister Gun-Mari Lindholm, replik

Talman! När det gäller språkbestämmelserna så kommer vi att titta på de bestämmelserna som man har för att få finskt medborgarskap. De bestämmelserna känner säkert den förra regeringen väl till när de gick igenom de här frågorna. Vi kommer att hålla oss ganska långt till det också.

När det gäller att göra det här i en snabbare takt så hade jag och vi i landskapsregeringen den ambitionen absolut. Nu har det visat sig att andra lagar har tagit längre tid än vad man hade förutspått, så därför har det blivit framskjutet och det är säkert också sådant som ni känner väldigt väl till att det kan gå så.

Vi har ambitionen att komma till lagtinget här på senhösten.

Ltl Katrin Sjögren, replik

Talman! Det var ju precis just det här som kritiserades tidigare, att det tog för lång tid. Det handlade om prioriteringar, det handlade om resurser och det handlade om att man inte prioriterade just de här frågorna.

Jag tror att liberalerna kommer att få rätt i den här hembygdsrättsfrågan, att ha lika behandling på alla som flyttar ut och att förlänga för alla. Det kommer att visa sig att det blir mycket komplicerat att ringa in de studerande.

Minister Gun-Mari Lindholm, replik

Talman! Vi kan återkomma till det här med lika behandling. Jag tycker att det är en väldigt intressant aspekt i det här sammanhanget. Vi kan konstatera att man ställer väldigt höga krav och det tycker jag att är bra att man gör för vi har väldigt höga ambitioner när det gäller den här landskapsregeringens arbete.

Sedan de här lagarna tillkom så har man försökt göra förändringar också under de fyra åren som ltl Sjögren och liberalerna ledde regeringen. Då kunde man inte heller komma fram. Men vi får väl önska den här regeringen bättre lycka på färden och att vi också kommer i mål med de ambitioner som vi har, som ni säkert också hade men inte kom i mål med.

Talmannen

Replikskiftet är avslutat.

Ltl Mats Perämaa, replik

Fru talman! Den förra landskapsregeringen åstadkom ett parlamentariskt arbete där det fanns en rätt stor enighet om vad man skulle göra. Nu är det frågan om att det inte görs.

Ministerns tvåårsperiod, det som enligt planerna ska bli två år, kommer att belastas av ett stort minus på grund av att ministern själv inte i lagform kommer att leda genom ett arbete genom lagtinget ens till någon del av detta.

Det sägs här svart på vitt i svaret på spörsmålet att gällande hembygdsrättsfrågor ska det här levereras under hösten. Men det tar betydligt längre tid än så för att hantera den frågan genom lagtinget. Sittande minister kommer att har två år på sig för att få till stånd ändringar i lagstiftningen, men ingenting av detta kommer att ske.

Minister Gun-Mari Lindholm, replik

Talman! Det är kanske lite för tidigt att döma om den här ministern kommer att leverera någon lagstiftning här under hösten.

I likhet med andra regeringar så har man haft den här ambitionen. Jag hoppas att vi lyckas. Jag tycker att vi har en enighet i de här frågorna, det finns ett bra dokument som ligger till grund och vi har en grupp som jobbar med det här. Vi har konkretiserade politiska ambitioner och intentioner. Det är en god bit på väg redan nu.

Ltl Mats Perämaa, replik

Fru talman! Att leverera någonting till lagtinget och få det igenom baxat i lagtinget under lagtingsbehandlingen är två skilda saker. Ministern kommer inte, om bytet sker såsom det var tänkt, att vara med och baxa igenom den här frågan ens gällande hembygdsrätt i lagtinget.

Total enighet om den parlamentariska kommitténs betänkande kanske det finns, men inte om allt annat. Landskapsregeringen skriver i sitt handlingsprogram att de här frågorna ska hanteras utifrån ett rättssäkert och jämlikt förfarande.

Under en behandling av en skriftlig fråga här tidigare så betonade ministern regeringens rätt att hantera frågor in casu, alltså från fall till fall. Den liberala gruppen är mera enig med det som står i landskapsregeringens handlingsprogram än det som ministern uttryckte häromsistens.

Minister Gun-Mari Lindholm, replik

Talman! Jag hoppas att jag också såsom lagtingsledamot, som en del av majoritetspartiet, ska vara med och bidra till att få de frågorna igenom.

Vad beträffar att reglera rättssäkerhet och andra frågor som är väldigt viktiga i de här sammanhangen vid likabehandlingsprincipen så de regelverken ska vi försöka att göra. Men, det finns också sådant som vi anser att man inte ska ändra, alltså in casu bedömningarna. Det är ett väldigt viktigt incitament också för både jordförvärvsregler och annat och det har jag förstått att har varit väldigt viktigt för liberalerna när man har gått in i arbetet med parlamentariska kommittén. Det finns ingenstans skrivet att in casu bedömningarna skulle tas bort på något sätt.

Talmannen

Replikskiftet är avslutat.

Ltl Gunnar Jansson, replik

Tack, fru talman! I förbindelse med frågan om förvärv av hembygdsrätt på ansökan har kopplingen till medborgarskap i Finland alltid nu och då varit en fråga av hög dignitet och den är ju inte alldeles oväsentlig nu i en EU-miljö. Spörsmålet som sådant innehåller inte några skrivningar om det och av naturliga skäl inte heller svaret. Nog får jag väl utgå ifrån att landskapsregeringen har en åsikt i ämnet trots det, när man nu avser att revidera landskapslagstiftningen om åländsk hembygdsrätt. Jag är mycket medveten om att grunderna för det här finns i självstyrelselagen och kräver en justering av den lagen i så fall. Men också den processen är aktuell. Finns det någonting att säga om kopplingen hembygdsrätt kontra medborgarskap nu i det här skedet av processen?

Minister Gun-Mari Lindholm, replik

Talman! Det har varit väldigt angeläget att ta bort detta med finskt medborgarskap, att även de som inte har finskt medborgarskap kunde få åländsk hembygdsrätt. Men vi vet också att den frågan råder vi inte allena över. Det är i så fall någonting som vi ska komma överens med Finlands regering och riksdag om, och det kanske är lite svårare än att komma överens med Ålands lagting om förändringar i de här lagarna som vi reglerar själva. Vi tar naturligtvis upp den här frågan när vi träffar de relevanta ministrarna och statsministern, men det är inte en fråga som vi kan bestämma över själva, vilket vi annars kan göra med de frågor som vi har satt upp som prioriterade.

Ltl Gunnar Jansson, replik

Tack, fru talman! Tack för beskedet. Diskussionen går säkert vidare där. Man borde ju inte byta ämne mellan replikerna men jag tar risken.

Får jag bara säga hur angelägen jag är om att en ny landskapslag om en åländsk hembygdsrätt stiftas i den ordning som en sådan lag tillkommer, att det den tiden är förbi när man i enkel ordning stiftade sådana lagar, som tyvärr skedde tidigare. Den lagen, om någon, behöver helgd. Vågar vi tro på att förslaget ger tvåtredjedelsmajoritet?

Minister Gun-Mari Lindholm, replik

Talman! Ja, det är en fråga som vi också har diskuterat, huruvida den ska tas med enkel eller kvalificerad majoritet. Den frågan kommer vi också att ta till behandling.

Talmannen

Replikskiftet är avslutat.

Ltl Brage Eklund, replik

Tack, fru talman! Minister Lindholm nämner arbetsgruppen som är tillsatt och som har börjat jobba med de här frågorna och framförallt riktar sitt arbete först mot hembygdsrättsfrågorna.

I sammanfattningen i kommittébetänkandet ges ett förslag på sju punkter som man behöver jobba med. Om jag förstod ministern rätt så sade hon att man har tagit ut vissa delar. Är det de här punkterna i hembygdsrättsfrågan eller är det punkter från det totala kommittébetänkandet? Vad är det som gäller?

Minister Gun-Mari Lindholm, replik

Ja, det är en bra fråga. Framförallt detta med svenskt medborgarskap, det är ingenting som vi rår över själva och som vi kan lagstifta ensidigt om. Så därför finns inte den punkten i arbetsgruppens prioriterade lagstiftningsområden.

Ltl Brage Eklund, replik

Tack, fru talman! När det gäller de övriga frågorna, följer man kommittébetänkandets förslag som utgångspunkt för arbetsgruppen eller kommer landskapsregeringen med andra förslag?

Minister Gun-Mari Lindholm, replik

Det materiella innehållet i kommitténs betänkande vad beträffar hembygdsrätten har vi haft som grund för våra prioriteringar.

Talmannen

Replikskiftena är avslutade.

Ltl Axel Jonsson

Fru talman! Som framgår av vårt spörsmål så den 26 maj 2010 undertecknade majoriteten av nuvarande ministrar, inklusive lantrådet ett spörsmål med lite samma tema som vi diskuterar idag. Jag syftar på Gun Carlson kommittén från 2009. Då skrev man; ” kommittén pekar i sitt betänkande på en rad åtgärder av vilka flera är brådskande och viktiga”. Sedan kom man i regeringsställning. Det har mycket riktigt gått tre år sedan spörsmålet och ett och halvt år sedan man hamnade i regeringen. Uppenbarligen har de här frågornas brådskande karaktär minskat av någon anledning, för några framställningar har vi ännu inte fått hit till lagtinget.

En fråga som bekymrar oss speciellt i Ålands Framtid är att vi egentligen aldrig har fått diskutera den materiella lagstiftningen som reglerar förvärv av fast egendom genom köp av aktier. En fråga av den här digniteten borde givetvis få diskuteras här i salen före vi utvecklar en förvaltningspraxis som vi kanske själva inte riktigt förstår vidden av eller att förvaltningspraxis följer det syfte som vi faktiskt här i salen vill att den ska följa.

Det är en så pass grundläggande fråga inom självstyrelsens kärnområden som lagtinget måste få diskutera och senast inom den här mandatperioden, helst redan i morgon. Det här är brådskande så som vi ser det i Ålands Framtid.

Vi känner alla till fallet Weise och fallet Havsvidden som några exempel när man har använt aktiebolag och aktieförvärv som ett verktyg för att få ägorätt och nyttjanderätt till fast egendom. Det här är sådant som vi onekligen måste få diskutera här i salen. Jag hoppas att mina kollegor håller med mig om det.

Att vi ännu inte fått konkreta lagförslag är givetvis klandervärt. Det ska också nämnas att det här är komplicerade frågor och lagstiftning som dock ställer krav på exakthet. Förhållande till EU-rätten och stand still klausulen som landskapregeringen nämner i sitt svar gör det ännu mera komplicerat. Därför ställer vi oss positiva att man har tillsatt den här arbetsgruppen. Vi ser nog lite skeptisk på frågan att det dröjer ända till slutet av hösten före vi får se det första förslaget här. Speciellt med tanke på ansvariga ministerns brösttoner här i slutet av sensommaren att man hade lösningen vad gäller hembygdsrätten om möjligheten till förlängning för de studerande och de skrivningar som man hade i sitt spörsmål redan för tre år sedan.

Med tanke på att vi är så relativt få här i salen idag och att det här är frågor som är av hög dignitet så föreslår jag, för att vi ska få fördjupa den här debatten ytterligare och verkligen få diskutera de här frågorna på allvar förrän vi kommer med den här lagframställningen, att vi bordlägger ärendet till nästa måndag. Jag ska fördjupa mitt anförande ytterligare då. Tack, fru talman

Ltl Harry Jansson

Tack, fru talman! Med risk för att ärendet bordläggs så kommer jag ändå på centergruppens vägnar att beröra dagens spörsmål.

Inledningsvis kan jag hålla med om det som kollegan Gunnar Jansson sade i ett replikskifte här. Det är ju unika rättsbegrepp vi har här på Åland. Det är viktigt att landskapslagstiftning rörande hembygdsrättsinstitutet regleras i en lag som antas i kvalificerad ordning, dvs. minst tvåtredjedelsmajoritet.

Jag tror att vi uttryckte det redan i samband med den liberala motionen om att förlänga hembygdsrättstiden för alla till åtta år, men jag poängterar samma sak nu; det är en lagstiftning som tillhör grundarna för hela vår särställning och därför bör den antas i den ordningen. Det är faktiskt märkligt hur det dåvarande åländska parlamentet resonerade när man gick in för en enkel lagstiftningsordning. Vi kan koppla det till den tidigare diskussion som vi har haft här idag vad gällde det svenska språket i åländsk myndighetsverksamhet.

För att det inte ska vara något tvivel om det så anser centern att det är oerhört viktigt att dagens krav på det finska medborgarskapet kan slopas. Det är förlegat med ett sådant krav. Åland är idag ett mobilt samhälle och vi har ett ansvar för att inte dagens diskriminering av nya ålänningar fortsätter på det här viset där man delar upp folk i olika rättigheter.

Spörsmålsställarna har ju formulerat sig som så att de särskilda komponenterna i vårt nationalitetsskydd; hembygdsrätten, jordförvärvsrätten och näringsrätten, utgör i viss mån inskränkningar i de grundläggande rättigheterna. Bästa kollegor, det är nog frågan om mycket djupa inskränkningar som de facto görs och som vi har möjlighet att vidta för Ålands del. Jag förstår mig inte riktigt på hur skriftställarna har resonerat.

Fru talman! När det gäller nationalitetsskyddet så måste vi komma ihåg att det är ett område som vi idag förfogar över i stort sett helt och hållet själva. Det är vi själva, Ålands lagting, som reglerar merparten av det som återfanns i Nationernas Förbunds beslut i synnerhet vad gäller Ålandsöverenskommelsen. Vi har de facto övertagit verkställigheten av Ålandsöverenskommelsen. I praktiken kan man säga att det fullbordades i samband med 1991 års självstyrelselag, alltså gällande självstyrelselag.  Det här ställer naturligtvis oerhörda krav på självstyrelseorganen, och på oss alla, att se till att vi har en lagstiftning som är klanderfri. Det är inte bra när vi har åländska förvaltningsbeslut som kullkastas av domstolar med hänvisning till att vi inte har följt den stringens, likställdhetskrav och annat som följer av dagens lagstiftning. Vi måste alla komma ihåg att när det gäller jordförvärvsbiten så är det någonting som har tillkommit före Finland fick sin nu gällande grundlag.

Jag tillhör dem som är övertygad om att vi aldrig idag skulle haft en möjlighet i dagens politiska miljö i Helsingfors att få igenom något liknande. Vi ska i alla fall vara glada över att vi har jordförvärvslagen i hamn och även de delar i självstyrelselagen som är av mer känslig natur.

När det gäller det aktuella spörsmålet så får centern nästan klä sig i säck och aska och vara mycket ödmjuka. Vi har ju varit med i två regeringar som inte har kunnat verkställa Gun Carlson kommitténs betänkande från 2009. Men i likhet med vad liberalerna och centern fick uppleva i den förra regeringen så har den nuvarande regeringen kunnat konstatera att de resurser som den här typen av lagstiftningspaket förutsätter inte finns. Centern har ingen anledning att betvivla kansliminister Lindholms ambitioner och inställning i den här sakfrågan. Det är nog mera en fråga om resurser. Där, fru talman, anser centern att vi inte får tveka att tillföra mera resurser till kärnfrågorna i det åländska självstyrelsesystemet. Det får inte haka upp sig på pengar när vi ska värna om själva pelarna för vår särställning. Jag kan bara uppmuntra landskapsregeringen att inte vara blyga när det gäller att äska om den typen av tilläggsanslag när nöden så kräver. Att se åländsk förvaltningspraxis få underkänt i domstolar är inte uppbyggande för någon ålänning.

Utöver det som berördes i replikskiftet, detta med rätt nivå på lagstiftning och kravet på finskt medborgarskap, så vill jag från centergruppens sida betona vikten av att vi faktiskt utreder vad stand still principen de facto innebär för Åland och vårt lagstiftande. Vilka begräsningar de facto är det fråga om?  Jag har själv försökt forska i det här ämnet tidigare och det är oerhört svårt att få fram någon praxis att börja leva efter. Skulle jag vara i landskapsregeringens kläder så skulle jag försöka få tag i en doktorand eller t.o.m. en färdig folkrättsforskare som skulle ta sig an den här problematiken. Det är sannerligen värt ett stipendium från Ålands sida för att få det här kartlagt.

Den åländska dimensionen är ju djupare än bara stand still principen som sådan. Vi har även folkrättspaket med oss in i det här. Jag hoppas att landskapsregeringen kan uppmuntra någon person att ta sig an det här. Personligen, fru talman, tror jag att vi ställer lite för stora krav på våra tjänstemän om de vid sidan av allt annat ska bedriva den typen av forskningsarbete som en ordentlig kartläggning av den mycket speciella frågeställningen faktiskt förutsätter.

Fru talman! Vi avvaktar landskapsregeringens kommande lagframställning som kommer att ta sikte på hembygdsrättsinstitutet till att börja med. Vad jag personligen kan tänka mig att kommer att uppstå är en frågeställning där landskapsregeringen tvingas ställa sig frågan; går det att lägga fram en ny lagstiftning gällande hembygdsrätten utan att man samtidigt lyfter på bordet alla de frågeställningar som då aktualiseras vad gäller jordförvärvsfrågan i synnerhet och primärt också näringsrätten? Om jag får ge ett svar så tror jag att landskapsregeringen samtidigt som man ger lagstiftningsförslaget om hembygdsrätten också borde komma med ett meddelande där hembygdsrättsinstitutet och det förslag som man lägger fram förklaras i ljuset av de andra delarna i det här unika rättsbegreppet som vi har här på Åland. Jag tror att ett meddelande skulle kunna ge landskapsregeringen möjlighet att vara lite mera frispråkig vad gäller den kommande behandlingen av de bitarna. Därmed får jag tacka för mig.

Vtm Viveka Eriksson, replik

Talman! Med tanke på historien när man tittar tillbaka på hela utvecklingen av den här lagstiftningen så var det ändå historiskt att vi under den förra perioden samlade parlamentet och fick ett gemensamt betänkande. Redan det var en stor framgång vill jag påstå. Sedan tar det tid och det är jättekomplicerad lagstiftning, det vet ltl Harry Jansson. När den förra spörsmålsdebatten hölls för ett och ett halvt år sedan, då sade ltl Harry Jansson ungefär samma sak att det måste till mera resurser. Jag håller med, det behövs lagberedningsresurser och andra resurser. Nu har ltl Harry Jansson alla möjligheter att gå till finansminister, säga att det ska vara mer resurser för centern är otåliga och vill ha resultat. Med den svansföring som förekom under den förra debatten så förväntar vi oss att landskapsregeringen ska åstadkomma resultat.

Ltl Harry Jansson, replik

Ja, finansminister Roger Nordlund har nog fått en mycket tydlig hälsning i samma riktning som vtm Eriksson nämner här. Men då måste också landskapsregeringen i övrigt vara överens om att den här insatsen krävs. Jag utgår ifrån att man kommer att diskutera i de termerna framöver.

Samtidigt får man konstatera att landskapsregeringen har ansett att det har funnits resurser för två tjänstemän inom ramen för en tjänstemannakommitté. Det är mycket möjligt att man anser att den expertisen är tillräcklig. Min särskilda anmärkning vad gällde det handlade om hela paketet som sådant. Jag återupprepar stand still biten, det är den typen av resurser som också måste sättas in.

Vtm Viveka Eriksson, replik

Talman! Som det brukar påminnas om här i lagtingsdebatten så fanns det i betänkandet 23 punkter som man skulle gå vidare med. Väldigt många av dem är lagtingsåtgärder. Liberalerna ser på precis samma sätt som andra partier, vi måste få flera av de punkter som idag finns som praxis eller tillämpningsdirektiv i lag. Därför att det ska vara tydligt för medborgarna att det ska vara likabehandlingsprincipen som gäller. Det är väldigt viktigt därför uppmuntrar vi centern och ltl Harry Jansson att verkligen puffa på sin regering och se till att det som man sade när man var i opposition faktiskt verkställs, kommer upp till bevis och levereras till lagtinget.

Ltl Harry Jansson, replik

Tack, fru talman! Jag vill ta fasta på det som vicetalmannen sade inledningsvis, enigheten som var mycket bra även för det fortsatta arbetet. En enighet som vi sedan också märkte av vad gällde självstyrelselagsreformen. Den tog ju bra fart under förra perioden. Vi fick även Gunnar Jansson kommittén vad gällde reformen som sådan, så det fanns mycket gott av enighet under den tidigare perioden och det är en enighet som vi bör bygga vidare på. Vi får, som sagt var, klä oss i säck och aska idag igen och bara lova att vi gör vad vi kan för att det här ska kunna förverkligas. 

Talmannen

Replikskiftet är avslutat.

Ltl Gunnar Jansson, replik

Tack, fru talman! Jag gillade kollegan Harry Janssons offensiva grepp i denna framställning. Emellertid, när vi för en tid sedan behandlade EU-meddelandet och jag lite klandrade kollegan där för den defensiva hållning som framgick i den texten så fick jag av ltl Harry Jansson förklaringen att det berodde på sportlovet. Beror nu denna defensiva hållning på påskhelgen, eller vad kan det vara? Jag har lite samma känsla av att man vill mera än vad texten nu utlovar. Var bromsar det, var kracklar det?

Jordförvärvslagen 1975, en parlamentarisk sensation som jag håller helt med att skulle vara omöjlig idag. Självstyrelselagen 1991 var också den ganska sensationell i den meningen att i landskapslagen ska vi materialisera grundlag i Finland och det är mycket unikt.

Ltl Harry Jansson, replik

Tack, fru talman! För de ledamöter som inte var närvarande när vi diskuterade EU-meddelandet så tror jag att min kollega Gunnar Jansson refererar till det faktum att vi inte på förhand hade tagit del av EU-meddelandet, antagligen beroende på sportlovet. Det var en liten randanmärkning.

Vad gäller sakfrågan så tycker jag inte att det är att vara särskilt offensiv att säga att vi behöver mera resurser och att vi måste ta ett helhetsgrepp som också skulle innefatta att alla tre rättsinstitut behandlas på en och samma gång. Vi får kanske nöja oss i första omgången med att vi enbart, nog så viktigt, kommer att diskutera hembygdsrättsinstitutet.  

Talmannen

Replikskiftet är avslutat.

Ltl Brage Eklund, replik

Tack, fru talman! Det vi pratar om idag är de särrättigheter som är grundläggande för vår självstyrelse. De svagheter som finns i beslutsprocesserna och hela rättsakterna har påpekats i betänkandet.

Det som lite förvånar mig är när man nu från centerhåll pratar om att det inte finns resurser. Man har suttit i regeringsställning ända sedan man bildade det här partiet och under den tiden hade man kunna påverka att resurserna och att det hade kommit klara regler och lagar vad som gäller när det gäller hembygdsrätt, jordförvärvsrätt och näringsrätt. Nu när vi har en ekonomisk situation där vi måste spara så då kan jag ha en viss förståelse för det här. Men fortfarande är allt detta alldeles för trögt.

Ltl Harry Jansson, replik

Då borde ju ltl Brage Eklund vara glad och lycklig över att jag då signalerar att det verkligen ska satsas på det här området oavsett det ekonomiska läget i övrigt. Det får inte bero på brist på resurser när det gäller de här grundläggande frågorna.

Vad gäller de frågeställningar som lyftes fram i Gun Carlson kommittén och dess betänkande så äger de sitt berättigande än idag. Det är en bra grund att jobba vidare på.  

Ltl Brage Eklund, replik

Tack, fru talman! När det gäller resursfrågor handlar det alltid om prioritering och vad som är viktigt och inte viktigt. Det är grundläggande frågor för självstyrelsen. Jag anser att man bör prioritera dem i första hand och kanske skjuta fram andra lagframställningar som är mindre viktiga. Där har tydligen den här landskapsregeringen prioriterat fel.

Ltl Harry Jansson, replik

Det är ju tyvärr som så, ltl Brage Eklund, att i och med EU-medlemskapet så är det andra spelare som bestämmer i vilken riktning vi ska föra den åländska bollen. EU-medlemskapet sätter ramarna för även lagberedningens arbete och även för övriga avdelningar inom självstyrelsens regeringskansli. Det är nog den biten igen som gör att resurserna inte vill räcka till. Men ledamoten och jag är helt överens om att det här är ett område som vi inte får försumma.

Talmannen

Replikskiftet är avslutat.

Ltl Katrin Sjögren, replik

Talman! Jag läste igenom den förra spörsmålsdebatten natten till idag och det var inte bra för nattsömnen. Jag kan också konstatera att ltl Harry Jansson är betydligt hovsammare än vad han var vid den tidigare spörsmålsdebatten. Då var man väldigt urväntad. Det fanns t.o.m. centerpartister som skrev under spörsmålet. Nog om detta.

Det som man kan konstatera och som ledamoten tog upp i sitt anförande är den här viktiga frågan om kopplingen till hembygdsrätten och finskt medborgarskap. Det nämns inte spörsmålssvaret och det nämns inte självstyrelsepolitiska redogörelsen. Är det ett icke fråga för majoriteten och landskapregeringen?

Ltl Harry Jansson, replik

Fru talman! Jag utgår ifrån att landskapsregeringen har begränsat sitt svar till själva spörsmålsfrågan som sådan där inte den aspekten lyfts fram. Jag antar att de har resonerat på det viset.

 Jag valde för min del att fortsätta de tankegångar som kollegan Gunnar Jansson lyfte här, att kopplingen till hembygdsrätten och finskt medborgarskap är en ytterst viktig aspekt när vi diskuterar hembygdsrätten. Här har vi från centergruppens sida efterlyst ett snabbspår för vissa grundläggande självstyrelsefrågor, ändringar av självstyrelselagen, i vissa frågor som inte kan vänta till 2022, 100-års firande när vi ska ha en ny modell av åländskt självbestämmande.

Ltl Katrin Sjögren, replik

Talman! Men jag kan inte dra mig till minnes i något som helst annat sammanhang att man har lyft fram den här frågan under de här ett och halvt åren som sittande landskapsregering har haft regeringsinnehav. Det får vi återkomma till, men det nämns inte i redogörelsen heller.

Ltl Harry Jansson, replik

När det gäller kravet på finskt medborgarskap i hembygdsrätten så kan vi alla konstatera att vi har misslyckats. Den kommitté som Aalto har lett på finska sidan skriver att från åländsk sida har det inte företagits någon aktivitet när det gäller den frågan. Med tanke på att vi har kunnat ta del av både landskapsregeringens framställningar till justitieministeriet och olika tidningsartiklar så vet vi alla att det påståendet inte stämmer. Den här frågan har ju aktualiserats, men det här visar väl hur lång väg vi har att jobba när det gäller den frågan.

Talmannen

Replikskiftet är avslutat.

Minister Gun-Mari Lindholm, replik

Talman! Det är bra att ltl Harry Jansson tar upp hembygdsrätt kontra jordförvärvsrätt för det har väldigt stor betydelse för egentligen är grunderna för jordförvärvsrätt att man innehar hembygdsrätt eller har bott här i fem år. Det är grundläget, allt annat än undantag. Jag tror i alla fall att när hembygdsrättsfrågan är väldigt genomgången så har man också många svar på jordförvärvsfrågorna.

När det gäller extra resurser så är vi eniga i landskapsregeringen om att om inte denna fråga nu kommer framåt i den takt som vi har ritat upp så då kommer vi också att anlita extern hjälp. De personer som nu idag sitter i arbetsgruppen, särskilt rättschefen Sören Silverström, är de som hanterar de här frågorna dagligdags och som känner till dem.

Ltl Harry Jansson, replik

Tack för den redogörelsen kansliministern. Det är helt rätt analyserat vad gäller de här tjänstemännen som är aktiva och känner till hur dagens förvaltningspraxis är och sannerligen hur de utformas från dag till dag. Samtidigt vet vi alla att vi begär ganska mycket av chefsjuristen i dessa dagar. Han är t.f. avdelningschef och allmän jurist för hela huset samt att vi behöver hans tjänster inom Roger Jansson kommittén etc. så vi lägger ganska stort ansvar på ett fåtal axlar. Vi borde ha en diskussion om det. Kanske det är så, fru talman, att vi har avskaffat autonomitjänsten, det vågar jag faktiskt inte säga, men den kanske vi har dragit in inom ramen för sparande. Men det är när det gäller den här typen av projekt som vi borde ha en den här autonomiexperten anställd.

Minister Gun-Mari Lindholm, replik

Talman! Man har tagit väldigt mycket praxisdokumentet och landskapsregeringsbeslut i de här frågorna och så har man valt att förfara i tidigare regeringar. För att få in praxis i lag nu så är det ju den personen som har hanterat frågorna som egentligen känner till praxis bäst och hur man har hanterat det. Därför är det ju väldigt värdefullt att ha den personen också med i den här gruppen. De andra ärendena som åligger den personen borde egentligen lyftas bort för att han ska kunna hantera de här frågorna. Jag är otålig och jag vill ha den här frågan väldigt fort framåt. Vi får se hur de här löper under april månad annars får vi ta in någon form av lagberedningshjälp för att få det här till lagtinget i den takt som vi nu har målat fram.

Talmannen

Replikskiftet är avslutat.

Ltl Mats Perämaa, replik

Fru talman! Med tanke på ltl Janssons ytterst försiktiga hovsamma hållning i den här frågan nu idag får man som utomstående betraktare intrycket av att centern trivs väldigt bra i det regeringssamarbetet där socialdemokraterna håller rorkulten. Det var andra tongångar då när det förra spörsmålet väcktes i precis samma fråga där centerns nuvarande gruppledare, som inte är närvarande idag, skrev på ett spörsmål. Samma argument för man fram nu, det saknas resurser men nu då på ett betydligt hovsammare sätt. Vi har en tilläggsbudget som landskapsregeringen antagit efter att det här spörsmålet lämnades in. Det står ingenting om lagberedningsresurser i den här frågan heller. Tilläggsbudgeten saknar reformer så man kunde åtminstone ha fokuserat på detta viktiga område.

Ltl Harry Jansson, replik

Det låter ju som om tidigare minister Mats Perämaa inte överhuvudtaget skulle ha varit involverad i diskussionen om jordförvärv och annat. Ledamoten var ju i högsta grad med om att förändra strandvillkoret på ett mycket märkligt sätt som vi har haft anledning att diskutera och kritisera från centerns sida. Ledamoten känner mycket väl till problematiken och speciella krav som ställs på där typen av frågor. Vad gäller att jag skulle vara mer hovsam idag än i tidigare debatter så det är möjligt. Man blir ju både äldre och visare och så har man ibland anledning att se sig själv i spegeln vad man inte har lyckats åstadkomma.

Ltl Mats Perämaa, replik

Fru talman! Det är ändå resultatet som räknas. Det kan ju vara trevligt att vi alla är hovsamma, delar på ansvaret och inte beskyller varandra så mycket. Det gäller nog att man tar tag ordentligt och från parlamentet tydligt säger att nu vill vi att det här ska åtgärdas om vi ska nå resultat. Det har sagts av många att detta ytterst komplicerade frågor. Det är väldigt lätt att lämna den här fråga till behandling någon gång i framtiden, eftersom man stöter på problemställningar som är svåra att hantera i vilket regeringssamarbete som helst. Jag tror nog att det krävs ytterst klara och tydliga ställningstaganden om vi ska komma vidare i den här frågan.

Ltl Harry Jansson, replik

Ja, ltl Perämaa, det var en bra slutkläm. Vi är helt överens om att det behövs ett fast roder när det gäller det här. Nu har vi faktiskt en minister som har en färdkarta för det genom en kommitté och hon har utlovat att vi ska ha lagstiftning på våra bord här i höst. Med tanke på allt det som har varit, hur komplicerad den här frågeställningen är samt detta med resurser så är vi för centerns del nöjda med hur frågan i detta nu hanteras.

Talmannen

Replikskiftena är avslutade.

Vtm Viveka Eriksson

Talman! Även liberalerna tycker att det är värt att bordlägga spörsmålssvaret och diskussion, särskilt mot bakgrund av att lantrådet inte är här idag. Det handlar om självstyrelsens kärnområden. Vi börja se att bänkarna är tomma och klockan är just 17.00. Därför ber jag att få understöda bordläggning och bordläggningstiden som ltl Axel Jonsson förslag. Jag ska återkomma i den fortsatta debatten med mitt anförande.

Talmannen

Ärendet kommer att bordläggas eftersom ltl Axel Jonsson, understödd av vtm Viveka Eriksson, har föreslagit att ärendet ska bordläggas till 08.04.2013. Önskar någon uttala sig bordläggningstiden?

Minister Gun-Mari Lindholm

Talman! Jag talade om för förslagsställaren för bordläggning, ltl Axel Jonsson, att jag inte är på plats på måndagen. Eftersom den här frågan ligger på mitt bord och jag är intresserad av den fortsatta debatten så skulle jag önska att ärendet bordläggs till onsdagen den 10 april.

Talmannen

Finns det förslag om annan bordläggningstid? Ärendet bordläggs till 08.04.2013.

På talarlistan finns ännu ledamöterna Anders Eriksson, Brage Eklund, Petri Carlsson, Danne Sundman och minister Gun-Mari Lindholm som får tillfälle att yttra sig.

Minister Gun-Mari Lindholm

Talman! Jag tar tillfället i akt nu eftersom ärendet blev bordlagt till en dag när jag inte kunde delta i debatten Jag skulle önska att ärendet bordlades till en dag där jag kunde delta för jag är väldigt angelägen om att få höra debatten. Jag hoppas att det här inte bara är ett skådespel utan att det har en konkretisering och en relevans för det fortsatta arbetet. Men jag får väl ta del av debatten på något annat sätt.

När det gäller det som ltl Mats Perämaa framförde om att det inte finns något med i tilläggsbudgeten, så det är helt riktigt och det är ett bra påpekande.

Jag har talat med finansministern om det här eftersom jag tycker att det kunde ha varit en bra en signal till lagtinget att ha ett anslag också för att visa på att det är ett angeläget område och att det behövs tilläggsresurser. Det finns också, vilket ni säkert vet om, ett anslag för inköp av externa tjänster och vi kommer att använda oss av det anslaget om vi går in för det. Det finns en viss problematik i inköp av externa tjänster för det är de som jobbar med de här frågorna dagligen som känner till alla de problemställningar och alla de svårigheter med anledning av att det är väldigt få av de här sakerna som är reglerade i lag. Det finns istället i praxisdokument och landskapsregeringsbeslut som inte på det sättet har en relevans och inte har den statusen som en lag. Det är svårt att föra in en helt extern person, men vi får se hur det löser sig. Från min och från landskapsregeringens sida så är det här ett vägval som vi har gjort. Vi har haft den här diskussionen i samband med tilläggsbudgeten och därför finns den inte heller här. Vi vill inte på det sättet belastat tilläggsbudgeten ytterligare med ett moment när vi vet att det borde finnas pengar till den här externa tjänsten. Jag är otålig, jag vill att det här arbetet ska framskrida och min svansföring har inte på något sätt blivit annorlunda eller lägre. Jag har också upplevt den verklighet som många av er har gjort tidigare. Det finns få personer som jobbar med de här sakerna, det är en liten förvaltning och att få igenom saker är inte så lätt som att bara säga att man vill ha det på sitt bord på måndag. Det finns många, många andra frågor och det dagliga arbetet tar också tid.

Jag kan försäkra er om att den här frågan är väldigt, väldigt aktuell hela tiden. Vi har varje vecka en avstämning om hur det här går framåt. Jag hoppas, och det är också lantrådets önskan, att jag ska kunna vara med och avge den här lagstiftningen till lagtinget.

Det finns många andra frågor som man har tangerat under den här debatten. Jag får väl ta del av dem i ett annat sammanhang. Jag ser att ni alla är ganska otåliga och vill gå hem, salen börjar tömmas. Jag tycker det är synd att man inte kunde ha bordlagt det här ärendet till ett annat datum. Tack.

Ltl Axel Jonsson, replik

Jag tycker, i likhet med ministern, att det är synd att hon inte har möjlighet att närvara på måndag. Vi ser det ändå den ordningen vi har idag att när lagtinget kallar så kommer ministrarna. Hela lagtingsgruppen har inte möjlighet att vara här på grund av andra lagtingsuppdrag på onsdag. Därför valde vi att vidhålla vårt förslag om måndag. Men det är tråkigt att inte ministern har möjlighet att komma. Om hon har möjlighet att påverka det så uppskattar vi det givetvis från vår sida.

Minister Gun-Mari Lindholm, replik

Det där är förstås en efterhandskonstruktion. Jag sade till ltl Axel Jonsson att jag var borta, men det är parlamentet som bestämmer. Jag tar del av den här diskussionen. Jag tycker att det är väsentligt att få ta del av den här diskussionen som parlamentet har. Trots det här spörsmålet så kan jag försäkra att det här arbetet ändå löper framåt.

Talmannen

Replikskiftet är avslutat.

Ltl Gunnar Jansson, replik

Tack talman! Processen som ministern hänvisade till och bekymren kring den, varför inte tillämpa den normala parlamentariska ordning som gäller här i lagtinget och i umgänget med landskapsregeringen?  Kollegan Harry Jansson pekade de facto på det och det har varit vägledande under årtionden i den här typen av lagstiftning; dvs. att regeringen lägger fram ett politiskt dokument om hur man avser att begå. Sedan kommer man till lagtinget och får vägkost, direktiv och det som begär och på basen därav ska utförs det tekniska förfarandet.

Jag får på något vis en känsla av att det här väver man in politik och juridik på ett sätt som riskerar att gå vilse. Tänk på vad kollegan Jansson sade!

Minister Gun-Mari Lindholm, replik

Talman! Till den delen håller jag inte riktigt med ltl Gunnar Jansson. Det finns redan ett politiskt dokument; den parlamentariska kommitténs betänkande som är som grund för det här. Vad beträffar fortsättningen så är det lagstiftningen som kommer i enlighet med det betänkandet.

Om man vill ha mer information till oppositionsgrupperna så ställer jag gärna upp på och diskuterar frågorna och jag inhämtar information och kunskap från grupperna. Men annars är det lagstiftning som kommer.

Talmannen

Replikskiftet är avslutat.

Ltl Mats Perämaa, replik

Herr talman! Det var tal om efterhandskonstruktion här. Det här talet om resurserna som nu finns känns dessvärre lite grann som efterhandskonstruktion och möjligheterna att använda resurser redan i april om man inte kommer vidare i arbetet såsom det är tänkt. Oppositionen här har väckt den här frågan ganska starkt idag och nu pratar man om det. Det står ingenting om det i tilläggsbudgeten. Om landskapsregeringen riktigt på allvar skulle vilja ha lagtingets besked om tilläggsresurser i denna fråga så finns det möjligheter att lämna kompletterande framställningar under den tiden som lagtinget behandlat tilläggsbudgeten. Det kunde göras.

Vi kommer senare i andra sammanhang att påvisa att det skulle krävas kompletterande framställning till den delen, till budgeten och till andra delar också. Här finns faktiskt ett exempel att efter den här behandlingen begära de resurser som krävs för att få det här arbetet i hamn.

Minister Gun-Mari Lindholm, replik

Talman! Jag tackar för det här stödet. Vi har för avsikt att klara det inom ramen, vilket vi också har olika budgetmoment för. Vi har strama ramar som har givits oss från lagtinget och de ramarna har vi för avsikt att följa. Är det så att man under något av de här momenten, som vi avser att vi kan använda, inte har tillräckligt med medel då återkommer vi till lagtinget. Då är det bra att veta att det här stödet finns.

Ltl Mats Perämaa, replik

Herr talman! Nu har vi en tilläggsbudget på bordet, nästa kommer tidigast i september och sannolikt blir det först en grundbudget för 2014. Om vi då i det skedet sedan ska konstatera att det skulle ha krävts mera resurser för tidsperioden efter det så då blir misslyckandet ännu större.

Vi ville säga detta med tilläggsresurser, precis som centern sade här via ltl Harry Jansson att centern också har begärt tilläggsresurser. Vi är fullt beredda att i det här skedet prata för att det här ska göras och det ska göras på ett professionellt sätt. Ministern här har tidigare sagt att man har prioriterat, med de resurser man har, annan lagstiftning för detta. Vi vill lyfta upp den här frågan i en högre prioritetsordning.

Minister Gun-Mari Lindholm, replik

Talman! Jag tycker att det är bra att ha det här stödet om det visar sig att vi behöver mera medel. Men vi försöker använda de pengar vi har på det mest förnuftiga sättet.

Talmannen

Diskussionen avbryts för idag.  Ärendet bordläggs till plenum 08.04.2013.

Enda behandling

8        Talmannens representationsersättning

Talmanskonferensens lagförslag (TMK 3/2012-2013)

Först tillåts diskussion och därefter vidtar detaljbehandlingen.

Diskussion. Ingen diskussion.

Detaljbehandlingen börjar. Talmannen föreslår att framställningen i dess helhet föreläggs för godkännande. Kan förfaringssättet godkännas? Godkänt.

Framställningen i dess helhet föreläggs för godkännande. Godkänd.

Ärendets enda behandling är avslutad. Ärendet är slutbehandlat.

Föredras

9        Förstärkning av rättssäkerheten i förvaltningen

Landskapsregeringens svar

Ltl Gunnar Janssons skriftliga fråga (SF 7/2012-2013)

Ärendet avförs från dagens föredragningslista.

Föredras

10      Tryggande av fårnäringen

Landskapsregeringens svar

Ltl Torsten Sundbloms skriftliga fråga (SF 8/2012-2013)

En fråga ska läsas upp av frågeställaren och efter det ger lantrådet eller en minister svar på frågan. Frågeställaren får sedan hålla högst två anföranden som också kan besvaras. Någon annan diskussion är inte tillåten.

För svaret på frågan tillämpas ingen tidsbegränsning medan övriga yttranden inte får överstiga tre minuter.

Svaret kommer att ges av minister Fredrik Karlström.

Ltl Torsten Sundblom

Tack, herr talman! Fårskötsel är en näring som passar utmärkt i skärgårdsförhållanden. Bland lantbrukare som idkar fårskötsel finns en oro för hur en växande lodjursstam kan påverka fårnäringens förutsättningar. Under vintern utfördes en lodjursinventering som rapporterade 7 lodjur varav 6 djur i skärgården.

Med hänvisning till 38 § 1 mom. lagtingsordningen ställer jag till vederbörande medlem av landskapsregeringen följande skriftliga fråga: Vilka näringspolitiska åtgärder avser landskapsregeringen vidta för att trygga fårnäringens framtid i ljuset av lodjurets etablering i betesmarkerna?

Minister Fredrik Karlström

Tack, herr talman! Jag värnar precis som ltl Torsten Sundblom om varje arbetsplats i skärgården. Jag brukar till och med säga att en arbetsplats i skärgården är viktigare än en arbetsplats på fasta Åland. Det är i alla fall betydligt bättre förutsättningar att skapa arbetsplatser på fasta Åland än vad det är i skärgården.

Fårnäringen är precis som Sundblom påpekar något som passar ypperligt i våra skärgårdsförhållanden och jag skulle gärna se ett projekt kring ”1000 får.ax” och fler får utplacerade på våra skärgårdsöar.

Däremot tror jag inte att det största hotet för en utökad fårnäring är den ökade lodjurspopulationen i skärgården. Vad som behövs för att den näringen ska lyckas och fungera är att det finns personer som vill syssla med fårskötsel, som kommer åt lämpliga markområden samt hittar sin nisch i marknaden och kan leverera en högklassig produkt till det lokala slakteriet.

Jag är helt övertygad om att de system vi har fyller kravet för vad samhället bör och kan ställa upp med för en företagare/fårägare som blir utsatt av ett lodjur. Som exempel kan jag passa på och berätta vad vi gör och vilka åtgärder vi har på kommande: Vi jobbar med ett utbildningsprogram för besiktningspersonal för att kunna bedöma skadorna som lodjuret förorsakar. Vi kan och har betalat ut ersättning för uppkomna skador utförda av lodjur, vilket jag anser vi har skyldighet till så länge vi har lodjuret fridlyst och ingen förvaltningsplan. Vi jobbar även med att inom kort ta fram principer och riktlinjer så att vi kan bevilja tillstånd för skyddsjakt då det uppkommer vissa ”problemlodjur” som specialiserat sig på att angripa husdjur.

Jag vill också passa på ur ett lo- och fårnäringsperspektiv berätta att enligt den senaste uppskattningen i Sverige, vintern 2010-2011, så finns det där mellan 1400 och 1900 lodjur.

Antalet får som under 2012 dödas av lodjur i hela Sverige var 99 stycken. Sätter vi det i relation till fårnäringen och skador lodjuren åstadkommer här på Åland inser vi att lodjuret inte är ett ”fårnäringspolitiskt hinder”.

En lodjursstam behöver därför inte automatiskt utgöra ett hot mot fårnäringen. Ofta är det en viss individ som börjar se får som ett lättfångat byte och då kan problem uppstå. För den enskilda fårägaren kan detta förstås vara kännbart men då har vi som sagt verktyg för att åtgärda det enskilda problemet och det finns medel upptaget i miljöbyråns budget att ersätta de skadorna.

Jag vill ändå när jag har möjlighet berätta att miljöbyrån och jaktenheten har börjat skissa på en förvaltningsplan för lodjuret. Åland har goda förutsättningar att hysa en population även om jag är helt övertygad om att de åländska lodjuren är en del av den finska populationen som för övrigt idag klassas som livskraftig. På Åland finns det tillräckligt stora skogsområden och det finns än så länge gott om föda i form av rådjur och dessutom har inte lodjuren några andra naturliga fiender här.

Tendensen på andra ställen har varit att lodjurets antal ökar snabbt så länge det finns gott om bytesdjur, på Åland är lodjurets favoritmål rådjur, men allt hänger ihop, när antalet lodjur når en kritisk nivå så får rådjursstammen problem. När rådjursstammen minskar får lodjuren brist på föda och väljer att angripa andra djur mer frekvent, när sedan den födan minskar leder det till att antalet lodjur minskar på grund av brist på föda, allt hänger ihop. Resultatet blir att rådjursstammen bli en bråkdel av idag och lodjuret stanna på en lägre nivå.

Den här utvecklingen har skett på andra områden där man inte satt förvaltningsåtgärder i tid. Utan ordnad förvaltning finns också risk för att illegal jakt uppstår och jag tycker det är bättre att ta till vara skinnet än att gräva ner eller sänka det.

Så avslutningsvis vill jag säga att en förutsättning för att ha lodjur på Åland är att vi har en livskraftig rådjursstam men lodjuret får inte äventyra den stammen.

Landskapsregeringen kommer nu utvärdera läget utgående från senaste vinterns inventering. Målet är att i första hand skapa en beredskap för sådana situationer där lodjur orsakar problem och sedan även arbeta fram en förvaltningsplan.

Jag är övertygad om att bästa sättet att ha en biologisk mångfald på Åland är att vi förvaltar vår viltresurs på absolut bästa tänka bara sätt. Bästa tänkbara sätt att fortsättningsvis ha lodjur på Åland är att vi har kontroll på hur de ska förvaltas och att vi värnar om våra rådjur och på det sättet värnar vi om våra får. Sålunda ser jag inte att lodjur är ett fårnäringspolitiskt hinder. Tack, herr talman.

Ltl Torsten Sundblom

Tack, herr talman! Det var ju glädjande att regeringen funderar på både förvaltningsplan och skyddsjakt. Mitt syfte med den här frågan var att lyfta fårnäringen. Jag ser möjligheter i fårnäringen när framtida generationsskiften sker i skärgården där vi har mycket mindre områden än på fasta Åland och områdena är kanske inte alla gånger lika lämpliga för köttdjur. Fårnäring skulle då passa bra.

Med en växande lodjursstam ute i skärgården, som vi åtminstone ser i Föglö och på Kökar finns det också föryngring, så får vi inte släppa stammen för långt. Då var just skyddsjakten och förvaltningsplanen ett bra svar. Jag är glad åt de 1000 fåren. För att förbättra möjligheterna för fårnäringen så skulle det behövas en charmoffensiv ute i skärgården med målsättningen att få 1000 nya tackor i skärgården, av det kan det också komma 1000 nya tackor på fasta Åland. Det skulle betyda en ökning för fårnäringen med cirka 45-50 procent och det skulle vara positivt.

Minister Fredrik Karlström

Herr talman! Jag lovar att inte bli långrandig, eftersom jag uppfattar att vi är ganska eniga i den här frågan. Vi är båda två starka förespråkare av en utökad fårnäring i skärgården. Vi inser också behovet av att man ska kunna ha en skyddsjakt där det finns principer och riktlinjer för hur det ska utövas om det finns enskilda individer som orsakar problem.

En charmoffensiv tror jag att jag skulle kunna vara ganska bra på att genomföra. Det krävs trots allt driftiga entreprenörer i grund och botten, för ledamot Karlström kommer nog inte att bli fåraherde den dagen han slutar med det här yrket. Däremot jobbar jag gärna för att det ska bli både får och tackor på Åland och i skärgården. Tack, herr talman.

Ltl Torsten Sundblom

Varför det är viktigt att hjälper den här näringen lite på traven är ju att det finns väldigt många som är i 60-70 års ålder i skärgården där vi har en ganska hög medelålder. En föryngring bland jordbrukarna skulle behövas.  I ljuset av det är jag glad att minister Karlström också tar i lodjursproblematiken som kommer att bli en växande bit.

Minister Fredrik Karlström

Jag ska sätta mig ner på kammaren och fundera lite hur vi skulle kunna göra en charmoffensiv och kanske skapa ”1000 får.ax eller 1000 far.ax ”(det kanske inte heller skulle vara fel med fler fäder på Åland överlag). Jag ska jobba vidare med de frågorna och lodjursfrågan är också aktuell.

Jag kan bara kort meddela att lagtingspartiet obunden samling kommer att kalla till ett seminarium kring de här frågorna med tankar och funderingar om hur man ska få förvaltningsplanen att fungera och utmaningarna som lodjuren medför. Seminariet ska hållas i slutet av april. Tack.  

Talmannen

Landskapsregeringens svar antecknas för kännedom. Ärendet är slutbehandlat.

För kännedom

11      Godkännande av avtalet med Botswana om upplysningar i fråga om skatteärenden

Republikens presidents framställning (RP 13/2012-2013)

Ärendet upptas till behandling vid plenum 08.04.2013.

12      Energideklaration för byggnader

Landskapsregeringens lagförslag (LF 13/2012-2013)

Ärendet upptas till behandling vid plenum 08.04.2013.

13      Förslag till första tilläggsbudget för år 2013

Landskapsregeringens budgetförslag (BF 3/2012-2013)

Ärendet upptas till behandling vid plenum 05.04.2013.

14      Redogörelse enligt 32 § AO för Ålands lagting för tiden 1 november 2011-31 oktober 2012

Landskapsregeringens redogörelse (RS 2/2012-2013)

Ärendet upptas till behandling vid plenum den 10.04.2013.

Plenum slutar

Nästa plenum hålls 05.04.2013 klockan 09.30. Plenum är avslutat.

Originalfil